PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00067571001
Common NameGSBRNA2T00067571001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CPP
Protein Properties Length: 605aa    MW: 66347.3 Da    PI: 7.2105
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00067571001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.73.5e-16325363240
                  TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                          ++k+CnCkkskClk+YCeCfaag++C e C+C dC+Nk 
  GSBRNA2T00067571001 325 SCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCIDCFNKP 363
                          689**********************************96 PP

2TCR52.31.1e-16410448139
                  TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                          ++k+gCnCkks+ClkkYCeC+++g+ Cs +C+Ce+CkN 
  GSBRNA2T00067571001 410 RHKRGCNCKKSNCLKKYCECYQSGVGCSINCRCEGCKNA 448
                          589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.4E-19324365IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.543325450IPR005172CRC domain
PfamPF036385.6E-12327362IPR005172CRC domain
SMARTSM011144.2E-17410451IPR033467Tesmin/TSO1-like CXC domain
PfamPF036385.6E-12412448IPR005172CRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 605 aa     Download sequence    Send to blast
MDTPQKTVTQ IETPVSKLKV ENSPVFNYIN SLSPITTVKS ISNAQTFSSL SFTSPPPVFT  60
TPHVASHKGS RFRSHSNSSD PSNKVVEEAL PEKEPPQILN NDCLTTTTPR VTNDGSCEDG  120
ETDLQKMCDD NVKRKSDTPD WETLISDSSD MLIYGSPNDS EAFRCFLQRS SDSKTRLCSG  180
SKPALPPVSQ SNEPESSDAL SILHRGVRRR CLDFEMPRNN NQTPRCVVPS IGLHLNAIAM  240
SSKDNNNVSK EYSFTGNVKV GLQSSTKTPV LPSDDIVREN ETREEAAGEE GLEEAPVSLA  300
LVEVSQSSPK KKRQVSEQAG EGESSCKRCN CKKSKCLKLY CECFAAGVYC IEPCSCIDCF  360
NKPIHEDTVL ATRKQIESRN PLAFAPKVIR NSDSTIEVGE DASKTPASAR HKRGCNCKKS  420
NCLKKYCECY QSGVGCSINC RCEGCKNAFG RKDGSSFAGM DTEQDQENET SGKSGTTIPL  480
PPSTPMPLRQ PLAQLPISSN NMLPSQQSQQ HLHGASLYNS QSFRKQDMGL MSHSRIETIA  540
EERAEDIENF IHSPVTNINA LSPNSKRVSL PHMDSTETTP WRRNGGRKLL LSSIPTFPSL  600
TPHH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A3e-1732944714120Protein lin-54 homolog
5fd3_B3e-1732944714120Protein lin-54 homolog
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous but expressed mostly in flowers and at significant levels in leaves. Detected with highest levels in developing ovules and microspores, and in petals. {ECO:0000269|PubMed:10769245, ECO:0000269|PubMed:18057042}.
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00044PBMTransfer from AT3G22760Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00067571001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2051421e-143AF205142.1 Arabidopsis thaliana CXC domain containing TSO1-like protein 1 (SOL1) mRNA, complete cds.
GenBankAY0996531e-143AY099653.1 Arabidopsis thaliana unknown protein (At3g22760) mRNA, complete cds.
GenBankAY1288371e-143AY128837.1 Arabidopsis thaliana unknown protein (At3g22760) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013751683.10.0protein tesmin/TSO1-like CXC 3
SwissprotQ8L5480.0TCX3_ARATH; Protein tesmin/TSO1-like CXC 3
TrEMBLA0A078JR380.0A0A078JR38_BRANA; BnaCnng56700D protein
STRINGBra023810.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22760.10.0Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]