PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00067245001
Common NameGSBRNA2T00067245001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family NF-YA
Protein Properties Length: 309aa    MW: 33768.9 Da    PI: 10.4317
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00067245001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA1032.8e-32185241158
            CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                          +ep++VNaKQyq+Il+RRq+Rakle+++kl +k+rkpylheSRh hAl+R+RgsgGrF
  GSBRNA2T00067245001 185 NEPIFVNAKQYQAILRRRQHRAKLEAQNKL-IKARKPYLHESRHLHALKRARGSGGRF 241
                          59****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005218.0E-37183244IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.866184244IPR001289Nuclear transcription factor Y subunit A
PfamPF020459.3E-27186241IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.5E-22187209IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860189209IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.5E-22218241IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010262Biological Processsomatic embryogenesis
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MQEFHSKDSL SSPTTSWGNS VLSNSNVQGS SSSAMTDNNN NNNTLSLTME MMSAHFPGMK  60
QTGFQLQGHD DSSSTLSTGG GESSGDVASL GGHNSNNRYG HNFVTHLSGH KEIAVSPSGS  120
HPKSILSKVS QNSAPPPTIE ASWPLHGNCF MSFPYASQHM VQQHPQIGGL MIPSRILLPH  180
NIPENEPIFV NAKQYQAILR RRQHRAKLEA QNKLIKARKP YLHESRHLHA LKRARGSGGR  240
FLNTKKLQES KSPPFLATSV KFRQREILGV AVGSSGPELT GNNMDMFQQD PQLRFSGYPS  300
NHHVSVLM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-19185253267NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in flowers and siliques. {ECO:0000269|PubMed:11250072}.
Functional Description ? help Back to Top
Source Description
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00067245001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009117205.10.0PREDICTED: nuclear transcription factor Y subunit A-6 isoform X1
RefseqXP_009117212.10.0PREDICTED: nuclear transcription factor Y subunit A-6 isoform X1
RefseqXP_009117216.10.0PREDICTED: nuclear transcription factor Y subunit A-6 isoform X1
RefseqXP_009117220.10.0PREDICTED: nuclear transcription factor Y subunit A-6 isoform X1
RefseqXP_009117226.10.0PREDICTED: nuclear transcription factor Y subunit A-6 isoform X1
SwissprotQ9LVJ71e-123NFYA6_ARATH; Nuclear transcription factor Y subunit A-6
TrEMBLA0A078HND20.0A0A078HND2_BRANA; BnaA01g29650D protein
TrEMBLA0A398AUR30.0A0A398AUR3_BRACM; Uncharacterized protein
TrEMBLM4DYD10.0M4DYD1_BRARP; Uncharacterized protein
STRINGBra021527.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM147331620
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G14020.11e-106nuclear factor Y, subunit A6
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  3. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]