PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00066453001
Common NameGSBRNA2T00066453001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family M-type_MADS
Protein Properties Length: 279aa    MW: 32291.2 Da    PI: 4.7468
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00066453001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF21.82.4e-071149341
                         --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE- CS
               SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifs 41
                         i + + r+ tf  R++ +  K +EL vLCd++ + +i+ 
  GSBRNA2T00066453001 11 ITDGRAREATFNLRKEELKQKLYELHVLCDVDTCAVIYN 49
                         6777899***************************99985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006613.82150IPR002100Transcription factor, MADS-box
SMARTSM004324.5E-7160IPR002100Transcription factor, MADS-box
CDDcd002661.30E-19285No hitNo description
SuperFamilySSF554551.96E-18295IPR002100Transcription factor, MADS-box
PfamPF003193.9E-101150IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MGKKKMDLTY ITDGRAREAT FNLRKEELKQ KLYELHVLCD VDTCAVIYNQ YDPNPEVWPS  60
NSEVKSVLEK FEMLSEKEKT CRSVNHEEFL HQMIEKARTK RQKQNDQNKE KYMRELMFAF  120
LSGNMEDLSL NNDDRSELCS FIDQYLKELV QHKNQTLNNP NFEIGQSSSM ALDMNIAQTS  180
IAEAGSSSFL VFKTSRSSKL TKMLQSVIST YHSDLPLDNF VASVPSTSSN EEVYIPVMNQ  240
DESYNQNQNQ NLEQGFVEEM MKIGEQTGFP WMEDNNRF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00066453001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018437602.11e-174PREDICTED: agamous-like MADS-box protein AGL80 isoform X1
TrEMBLA0A078HM650.0A0A078HM65_BRANA; BnaC01g28010D protein
STRINGBo1g088030.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28700.14e-85AGAMOUS-like 46
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]