PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00065871001
Common NameGSBRNA2T00065871001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRAS
Protein Properties Length: 511aa    MW: 56010.2 Da    PI: 4.4537
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00065871001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS435.15.3e-1331415001374
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                          lv++L++cAeav++++l la+al++r+  la++++ +m ++a+yf+eALa+r++r        ++ps+ + + s ee+     f+e +P+
  GSBRNA2T00065871001 141 LVQALVACAEAVHQENLILADALVKRVGSLAASQAGAMGKVATYFAEALARRIYR--------IRPSSPAVDPSFEEILQ-MHFYESCPY 221
                          689****************************************************........55555554445555444.46******* PP

                 GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnv 180
                          lkf+h+taNqaIleav++++ vH+iD++i+qG+QWpaL+qaLa Rp+g+ps+R+Tgvg p+  + + ++++g++La++A+++gv+fef+ 
  GSBRNA2T00065871001 222 LKFAHFTANQAILEAVATARGVHVIDLGINQGMQWPALMQALALRPGGSPSFRLTGVGGPS--EGDGIQQLGWKLAQLAQAIGVEFEFKG 309
                          ***********************************************************88..99************************* PP

                 GRAS 181 lvakrledleleeLrvkp.gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfd 269
                          l+++rl+dle+e+++++p  E+l+Vn+v++lh+ll++++s+e+    +L +vk ++P +++vveqea+hn+  Flerf eal+yys+lfd
  GSBRNA2T00065871001 310 LTVERLTDLEPEMFETRPeSETLVVNSVFELHQLLAQPGSIEK----LLATVKAVKPSILTVVEQEANHNGVVFLERFNEALHYYSSLFD 395
                          ******************9************************....******************************************* PP

                 GRAS 270 sleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgsl 358
                          sle ++   s++r+ +++++lgr+i nvva+eg++r+erhetl +Wr+r+++aGF pv+l+++a kqa+lll+  + +dgyrvee++gsl
  GSBRNA2T00065871001 396 SLEDGVIIPSQDRV-MSEVYLGRQILNVVAAEGTDRIERHETLDQWRKRMGSAGFDPVSLGSDAFKQASLLLALSGgGDGYRVEENDGSL 484
                          *****988887775.66677********************************************************************** PP

                 GRAS 359 vlgWkdrpLvsvSaWr 374
                          +l W+++pL+++SaW+
  GSBRNA2T00065871001 485 MLAWQTKPLIAASAWK 500
                          ***************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011295.9E-341284No hitNo description
PfamPF120411.8E-311278IPR021914Transcriptional factor DELLA, N-terminal
PROSITE profilePS5098564.244115479IPR005202Transcription factor GRAS
PfamPF035141.8E-130141500IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 511 aa     Download sequence    Send to blast
MGKKLEDDNN MDEFLSALGY KVRSSDMADV AQKLEQLEVV LSNDDVLDSN ALNDTVHYNP  60
SDLSSWAETM LSELNYYPPS LDLDPTRMCN LTPFSDDNEC SSTTSDNSSK RIRLGPWCDS  120
SESTRPVVML GVDSQETGVR LVQALVACAE AVHQENLILA DALVKRVGSL AASQAGAMGK  180
VATYFAEALA RRIYRIRPSS PAVDPSFEEI LQMHFYESCP YLKFAHFTAN QAILEAVATA  240
RGVHVIDLGI NQGMQWPALM QALALRPGGS PSFRLTGVGG PSEGDGIQQL GWKLAQLAQA  300
IGVEFEFKGL TVERLTDLEP EMFETRPESE TLVVNSVFEL HQLLAQPGSI EKLLATVKAV  360
KPSILTVVEQ EANHNGVVFL ERFNEALHYY SSLFDSLEDG VIIPSQDRVM SEVYLGRQIL  420
NVVAAEGTDR IERHETLDQW RKRMGSAGFD PVSLGSDAFK QASLLLALSG GGDGYRVEEN  480
DGSLMLAWQT KPLIAASAWK VSDVTAEWRR *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-581415004375GRAS family transcription factor containing p
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00065871001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009107522.10.0PREDICTED: DELLA protein RGL3
SwissprotQ9LF530.0RGL3_ARATH; DELLA protein RGL3
TrEMBLA0A078HM390.0A0A078HM39_BRANA; BnaA10g17240D protein
STRINGBra013973.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM83728121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17490.10.0RGA-like protein 3
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]