PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00065179001
Common NameGSBRNA2T00065179001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CPP
Protein Properties Length: 287aa    MW: 31249.6 Da    PI: 9.0085
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00065179001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR475e-1585124141
                  TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                          ++kk+CnCk+s+Clk+YCeCfa+g++C+  C+C +C+N+ +
  GSBRNA2T00065179001  85 QKKKHCNCKHSRCLKLYCECFASGTYCDG-CNCINCFNNVD 124
                          589**************************.********986 PP

2TCR52.41e-16163201139
                  TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                          k++kgCnCkks ClkkYCeCf+a+  Cse+CkC dCkN 
  GSBRNA2T00065179001 163 KHNKGCNCKKSGCLKKYCECFQANILCSENCKCLDCKNF 201
                          589***********************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011145.2E-1785125IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163435.7186203IPR005172CRC domain
PfamPF036382.1E-1187122IPR005172CRC domain
SMARTSM011147.5E-19163204IPR033467Tesmin/TSO1-like CXC domain
PfamPF036383.1E-13166201IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MGNAGGGGKL PPKNDGGFGA PARDPARQLD EHSRPKPAPT VVTSSLHPVA MSQSQILNAP  60
IRLSRQESPQ SRPMPIVEGR DGTPQKKKHC NCKHSRCLKL YCECFASGTY CDGCNCINCF  120
NNVDNEPARR DAVEATLERN PNAFRPKIAH GVRDKREMVL LGKHNKGCNC KKSGCLKKYC  180
ECFQANILCS ENCKCLDCKN FDGSEERQAL FHGEHANNMA YLQQAGNAAI TGAVGFSGFA  240
PYPASKRRKG GQDISFSHAT KDTSSATGPS KFVYRCVSQV ILLIQRA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A6e-33782122132Protein lin-54 homolog
5fd3_B6e-33782122132Protein lin-54 homolog
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous but expressed mostly in flowers. {ECO:0000269|PubMed:18057042}.
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00065179001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1186581e-158AK118658.1 Arabidopsis thaliana At4g29000 mRNA for putative transcription factor, complete cds, clone: RAFL19-93-A20.
GenBankBT0059311e-158BT005931.1 Arabidopsis thaliana At4g29000 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009137820.10.0PREDICTED: protein tesmin/TSO1-like CXC 5
SwissprotQ9SZD11e-135TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A078JJ460.0A0A078JJ46_BRANA; BnaAnng24750D protein (Fragment)
STRINGBra024171.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-137Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]