PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00064797001
Common NameGSBRNA2T00064797001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 205aa    MW: 23605.9 Da    PI: 9.1103
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00064797001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_136.78.9e-1286146262
                          XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                          k+ +  +rk +NRe+ArrsR +K+++++ L+    +L +eN++L ++l     +++   +e
  GSBRNA2T00064797001  86 KDERQKKRKKSNRESARRSRMKKQKYLDDLRSQLNQLNTENRELENQLRYVMHHCQGANME 146
                          4556678999***********************************9999999999866555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1704.0E-1084139No hitNo description
SMARTSM003383.2E-1385149IPR004827Basic-leucine zipper domain
PfamPF001708.6E-987142IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.86487133IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.13E-1089140No hitNo description
CDDcd147021.11E-1690141No hitNo description
PROSITE patternPS00036092107IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MSSILPGFLS QQILANHLQT LETRFTPWDD ASDIFSIFNS PVCPVEVNPA VEKTNSCQVL  60
NKSDPCPGME DRPSNLTGLN VFFPKKDERQ KKRKKSNRES ARRSRMKKQK YLDDLRSQLN  120
QLNTENRELE NQLRYVMHHC QGANMENDRL RVENQILHEK LMSLRQALVL RQIQQSSTCA  180
TWSCVNSTVV TVHQNPSMLR DHVI*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
189107QKKRKKSNRESARRSRMKK
29094KKRKK
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00064797001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013619717.11e-132PREDICTED: regulatory protein opaque-2-like
TrEMBLA0A078HJJ01e-150A0A078HJJ0_BRANA; BnaAnng05020D protein
TrEMBLA0A398AJZ81e-150A0A398AJZ8_BRACM; Uncharacterized protein
STRINGBo2g168170.11e-131(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33382665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49760.18e-37basic leucine-zipper 5
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]