PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00063354001
Common NameGSBRNA2T00063354001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRAS
Protein Properties Length: 421aa    MW: 46707.5 Da    PI: 6.608
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00063354001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS394.41.2e-12010042051374
                 GRAS  51 arlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp 140
                          + l++s+s++ykal++++ +     e l+++++++e++P++kf++  aN aI eav++e+ vHiiDf+isqG+QW++L++aL +Rp+gpp
  GSBRNA2T00063354001 100 TELTSSGSSIYKALRCKDPT---GPELLTYMHILYEACPYFKFGYESANGAIAEAVKNESFVHIIDFQISQGGQWVSLIRALGARPGGPP 186
                          578999*************9...9****************************************************************** PP

                 GRAS 141 slRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevL 228
                          ++RiTg+++p+s+  ++  le +g+rL k+Ae +gvpfef+  +a  ++++e+e+L v++gEalaVn+ l lh+++desv++e++rd++L
  GSBRNA2T00063354001 187 RVRITGIDDPRSSfaRQGGLELVGQRLGKLAEMCGVPFEFHG-AALCCTEVEIEKLGVRNGEALAVNFPLVLHHMPDESVTVENHRDRLL 275
                          **********999999**************************.899******************************************** PP

                 GRAS 229 klvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrer 318
                          +lvk+lsP+vv++veqea++n+++Fl rf+e++++y a+f+s+++kl+r+++eri+vE+++l+re+vn++aceg er+erhe l+kWr+r
  GSBRNA2T00063354001 276 RLVKRLSPNVVTLVEQEANTNTAPFLPRFVETMNHYLAVFESIDVKLARDHKERINVEQHCLAREVVNLIACEGVEREERHEPLGKWRSR 365
                          ****************************************************************************************** PP

                 GRAS 319 leeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                          +++aGFkp+pls+++++++k ll+ ++++ y++ee++g+l+lgWk++pL++ +aWr
  GSBRNA2T00063354001 366 FHMAGFKPYPLSSYVNATIKGLLESYSEK-YTLEERDGALYLGWKNQPLITSCAWR 420
                          ***************************65.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098555.39124401IPR005202Transcription factor GRAS
PfamPF035144.2E-118100420IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005829Cellular Componentcytosol
Sequence ? help Back to Top
Protein Sequence    Length: 421 aa     Download sequence    Send to blast
MEATQKHIIQ DGSSMFYHQP SVKQMDISVQ TFDSYCTLES SSGTKSHPCP NNNITSSTTS  60
FSSNGSPVSH SNNNNNTSHL SPDNNNSPLS GSSATNNNET ELTSSGSSIY KALRCKDPTG  120
PELLTYMHIL YEACPYFKFG YESANGAIAE AVKNESFVHI IDFQISQGGQ WVSLIRALGA  180
RPGGPPRVRI TGIDDPRSSF ARQGGLELVG QRLGKLAEMC GVPFEFHGAA LCCTEVEIEK  240
LGVRNGEALA VNFPLVLHHM PDESVTVENH RDRLLRLVKR LSPNVVTLVE QEANTNTAPF  300
LPRFVETMNH YLAVFESIDV KLARDHKERI NVEQHCLARE VVNLIACEGV EREERHEPLG  360
KWRSRFHMAG FKPYPLSSYV NATIKGLLES YSEKYTLEER DGALYLGWKN QPLITSCAWR  420
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-5812242075375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.36691e-160root| seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00063354001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3527240.0AK352724.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-03-J19.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013592147.10.0PREDICTED: scarecrow-like protein 5 isoform X1
SwissprotQ8H1250.0SCL5_ARATH; Scarecrow-like protein 5
TrEMBLA0A078HIE90.0A0A078HIE9_BRANA; BnaC06g03750D protein
STRINGBra018860.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM62128141
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50600.10.0scarecrow-like 5
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]