PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00062115001
Common NameGSBRNA2T00062115001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WRKY
Protein Properties Length: 400aa    MW: 43882 Da    PI: 7.8564
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00062115001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY77.71.3e-24103159259
                          --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          +Dgy+WrKYGqK vk+ + +rsYYrCt+++C++kk +e+s++ ++v+ei+++g+H he
  GSBRNA2T00062115001 103 RDGYHWRKYGQKRVKSPRGSRSYYRCTYSDCCAKK-IECSNDSGNVIEIVNKGSHSHE 159
                          7********************************98.*********************8 PP

2WRKY97.49.6e-31264320359
                          -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          Dgy+WrKYGqK+vkg+++pr+YYrCtsagC+v+k++e++ e+ ++v+itY+g Hnh+
  GSBRNA2T00062115001 264 DGYRWRKYGQKMVKGNPNPRNYYRCTSAGCSVRKHIETAVENRTAVVITYKGVHNHD 320
                          9*******************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.4E-1999160IPR003657WRKY domain
SuperFamilySSF1182905.75E-19100159IPR003657WRKY domain
SMARTSM007742.4E-21102160IPR003657WRKY domain
PfamPF031061.8E-16104158IPR003657WRKY domain
PROSITE profilePS5081114.986104161IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.1E-31247322IPR003657WRKY domain
PROSITE profilePS5081131.823257322IPR003657WRKY domain
SuperFamilySSF1182901.83E-26258322IPR003657WRKY domain
SMARTSM007741.7E-33262321IPR003657WRKY domain
PfamPF031066.5E-23264320IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 400 aa     Download sequence    Send to blast
MDDKDSCEAD VYAAAETEKG EKVDPEKELC HGDDDGLSQL RGEESLTDME GLPVRETLAK  60
DHVEDVRENS SVEPNREDVK EQISDSRVVS NLSVSPVLRT PARDGYHWRK YGQKRVKSPR  120
GSRSYYRCTY SDCCAKKIEC SNDSGNVIEI VNKGSHSHEP LRKNSFSPRE TRAASVIPPV  180
TEDNTVVPTG SALSISTKEN VCQSLAIVEG KRNCENEAVE EPEPKRRQVL LKKSNSQSSD  240
TVSKPGKKHK VVVHAAGDVG ISGDGYRWRK YGQKMVKGNP NPRNYYRCTS AGCSVRKHIE  300
TAVENRTAVV ITYKGVHNHD MPVPKKRHGP PSSALVAAAA PTSMRTRLED QVNIPTSGQC  360
SVGRESERQS SEGVDVGGGE KVMESARTLL SIGFEIKQC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A3e-25253323878Probable WRKY transcription factor 4
1wj2_A3e-25253323878Probable WRKY transcription factor 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00062115001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM5931420.0KM593142.1 Brassica oleracea var. capitata WRKY transcription factor (WRKY35) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013659449.10.0PREDICTED: probable WRKY transcription factor 32
SwissprotP595830.0WRK32_ARATH; Probable WRKY transcription factor 32
TrEMBLA0A078HI440.0A0A078HI44_BRANA; BnaC03g67830D protein
STRINGBra010266.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63382844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.11e-178WRKY DNA-binding protein 32
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]