PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00061319001
Common NameGSBRNA2T00061319001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 596aa    MW: 65472.2 Da    PI: 6.5978
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00061319001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1391.7e-12152212363
                          XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                          + k+  r+++NRe+A+ sR+RKk+++eeL+ kvk++ +   +L  +++    e a+l+++ 
  GSBRNA2T00061319001 152 DEKKKARLIRNRESAQLSRLRKKQYVEELQGKVKSMNSTIAELNGKISYVMAENAALRQQM 212
                          679999****************************************999999999999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1708.3E-16143214No hitNo description
SMARTSM003389.6E-16150214IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.105152215IPR004827Basic-leucine zipper domain
PfamPF001702.7E-10153212IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.5E-11154212No hitNo description
CDDcd147048.05E-18155206No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006990Biological Processpositive regulation of transcription from RNA polymerase II promoter involved in unfolded protein response
GO:0009408Biological Processresponse to heat
GO:0005635Cellular Componentnuclear envelope
GO:0005654Cellular Componentnucleoplasm
GO:0005783Cellular Componentendoplasmic reticulum
GO:0016021Cellular Componentintegral component of membrane
GO:0048471Cellular Componentperinuclear region of cytoplasm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 596 aa     Download sequence    Send to blast
MTESTFSIAN PPDLNPNTLP DPEMISVPPL DPLFLSASDP ISDLSFLLDD ENGDLADLDF  60
SFDDSVDFFD FDLDADLPVA ITESIATHAD MDSPEIKIVD RGLEDRSDSV HSQVSSQGSK  120
SKRKKGNSGG EYRSFKYQKS DEKSASPVEE DDEKKKARLI RNRESAQLSR LRKKQYVEEL  180
QGKVKSMNST IAELNGKISY VMAENAALRQ QMMAASGAPM NPYMAPPPLP YQWMPYPYGS  240
QIPLVPKLPL PSCSRPKKGE GRSKRKKVAS ISFIGILFFM FLFGMLVPFM NVDNGGDRGL  300
AKYEGRRYYD EHRGKVLMVG DGSDVRRESV CSSRDSCGGV EGRLSNASEP LFAFLYVPRN  360
DGLVKIDGDL IIHSVLASEK AKKNVSETIK SEEPYLTVPG ALSSALAVPD VRGNGAMLPH  420
SSKALSSGSP DGKRLHQWFH EGGAGTLMDY SMCTEVFQFD ISPGAIVPSS VSNITREHLQ  480
NVTTTRHKRM KNRRILEGLP VSRLASELNI TEAQASKDAQ NKSFHGKDNT KPTSSSMVVS  540
VLLDPREVVD SETDRVMPSN PKSLSRIFVV VLLDSVKYVT YSCVLPRSGL HLVAT*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.145710.0seed
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator involved in ER stress responses. Functions as a stress sensor and transducer in ER stress signaling pathway. After proteolysis by SBT6.1 (S1P) and S2P, the N-terminal bZIP component is translocated to the nucleus, where it activates the expression and production of ER chaperones (PubMed:18156219, PubMed:18634751, PubMed:18849477, PubMed:20876872). Following ER stress, activates proteins involved in brassinosteroid (BR) signaling, which is required for stress acclimation and growth (PubMed:20876872). {ECO:0000269|PubMed:18156219, ECO:0000269|PubMed:18634751, ECO:0000269|PubMed:18849477, ECO:0000269|PubMed:20876872}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00345DAPTransfer from AT3G10800Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00061319001
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By heat shock. {ECO:0000269|PubMed:18849477}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3531170.0AK353117.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-21-B04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009114935.10.0PREDICTED: bZIP transcription factor 28-like
RefseqXP_013731441.10.0bZIP transcription factor 28-like isoform X1
RefseqXP_022546644.10.0bZIP transcription factor 28-like isoform X2
SwissprotQ9SG860.0BZP28_ARATH; bZIP transcription factor 28
TrEMBLA0A078FH260.0A0A078FH26_BRANA; BnaA09g24670D protein
STRINGBra023224.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM143971822
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10800.10.0bZIP family protein
Publications ? help Back to Top
  1. Deng Y,Srivastava R,Howell SH
    Protein kinase and ribonuclease domains of IRE1 confer stress tolerance, vegetative growth, and reproductive development in Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 2013. 110(48): p. 19633-8
    [PMID:24145452]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Nagashima Y,Iwata Y,Ashida M,Mishiba K,Koizumi N
    Exogenous salicylic acid activates two signaling arms of the unfolded protein response in Arabidopsis.
    Plant Cell Physiol., 2014. 55(10): p. 1772-8
    [PMID:25138441]
  4. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  5. Sun L,Zhang SS,Lu SJ,Liu JX
    Site-1 protease cleavage site is important for the ER stress-induced activation of membrane-associated transcription factor bZIP28 in Arabidopsis.
    Sci China Life Sci, 2015. 58(3): p. 270-5
    [PMID:25634523]
  6. Zhang L,Chen H,Brandizzi F,Verchot J,Wang A
    The UPR branch IRE1-bZIP60 in plants plays an essential role in viral infection and is complementary to the only UPR pathway in yeast.
    PLoS Genet., 2015. 11(4): p. e1005164
    [PMID:25875739]
  7. Ma ZX, et al.
    The THERMOSENSITIVE MALE STERILE 1 Interacts with the BiPs via DnaJ Domain and Stimulates Their ATPase Enzyme Activities in Arabidopsis.
    PLoS ONE, 2015. 10(7): p. e0132500
    [PMID:26186593]
  8. Sagor GH, et al.
    The polyamine spermine induces the unfolded protein response via the MAPK cascade in Arabidopsis.
    Front Plant Sci, 2015. 6: p. 687
    [PMID:26442007]
  9. Kørner CJ,Du X,Vollmer ME,Pajerowska-Mukhtar KM
    Endoplasmic Reticulum Stress Signaling in Plant Immunity--At the Crossroad of Life and Death.
    Int J Mol Sci, 2015. 16(11): p. 26582-98
    [PMID:26556351]
  10. Zeng Y, et al.
    Unique COPII component AtSar1a/AtSec23a pair is required for the distinct function of protein ER export in Arabidopsis thaliana.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(46): p. 14360-5
    [PMID:26578783]
  11. Meng Z,Ruberti C,Gong Z,Brandizzi F
    CPR5 modulates salicylic acid and the unfolded protein response to manage tradeoffs between plant growth and stress responses.
    Plant J., 2017. 89(3): p. 486-501
    [PMID:27747970]
  12. Nawkar GM, et al.
    HY5, a positive regulator of light signaling, negatively controls the unfolded protein response in Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(8): p. 2084-2089
    [PMID:28167764]
  13. Iwata Y, et al.
    Activation of the Arabidopsis membrane-bound transcription factor bZIP28 is mediated by site-2 protease, but not site-1 protease.
    Plant J., 2017. 91(3): p. 408-415
    [PMID:28407373]
  14. Zhang SS, et al.
    Tissue-Specific Transcriptomics Reveals an Important Role of the Unfolded Protein Response in Maintaining Fertility upon Heat Stress in Arabidopsis.
    Plant Cell, 2017. 29(5): p. 1007-1023
    [PMID:28442596]
  15. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  16. Kataoka R,Takahashi M,Suzuki N
    Coordination between bZIP28 and HSFA2 in the regulation of heat response signals in Arabidopsis.
    Plant Signal Behav, 2017. 12(11): p. e1376159
    [PMID:28873003]
  17. Ruberti C,Lai Y,Brandizzi F
    Recovery from temporary endoplasmic reticulum stress in plants relies on the tissue-specific and largely independent roles of bZIP28 and bZIP60, as well as an antagonizing function of BAX-Inhibitor 1 upon the pro-adaptive signaling mediated by bZIP28.
    Plant J., 2018. 93(1): p. 155-165
    [PMID:29124827]
  18. Kim JS,Yamaguchi-Shinozaki K,Shinozaki K
    ER-Anchored Transcription Factors bZIP17 and bZIP28 Regulate Root Elongation.
    Plant Physiol., 2018. 176(3): p. 2221-2230
    [PMID:29367234]