PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00061084001
Common NameGSBRNA2T00061084001, LOC106357696, LOC106402406
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 427aa    MW: 47103 Da    PI: 6.7333
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00061084001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.29.9e-10281336560
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60 
                          kr +r   NR +A rs +RK  +i eLe kv++L++e ++L  +   l+  +  l+
  GSBRNA2T00061084001 281 KRVKRILANRQSAARSKERKMRYIVELEHKVQTLQTEATTLSAQFTLLQRDMMGLT 336
                          899**************************************999888877666555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.5E-17277341IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.415279342IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.7E-11281336No hitNo description
SuperFamilySSF579591.29E-11281337No hitNo description
PfamPF001701.7E-8281329IPR004827Basic-leucine zipper domain
CDDcd147032.00E-22282331No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 427 aa     Download sequence    Send to blast
MGDTDTDMIH RLHSPFGKQP QQLQLNPKPP TSPYSQIQNL NPVGATTSHS RSMSQPSSFF  60
SFDSLPPLSP SPFNNNNNNN PSSSLLPPSP FTRCNSDSSR VVLPPRKSHR RSNSDISGGE  120
SADWSTKTTP PFVKKESGER EDMDDLFSAY MNLENIDALN SPEADRASGT KTNGSDDTEG  180
ESSSVNYESG GDRNNSLKRR AGAGGGDIAP TSRHYRSVSV DSCFMEKMSF GEDSLKPPST  240
NSVDGGSAFS IEFKNGEFNA AEMKKIMAND KLAEMAVSDP KRVKRILANR QSAARSKERK  300
MRYIVELEHK VQTLQTEATT LSAQFTLLQR DMMGLTNHNN ELKFRLQAME QQAQLRDALS  360
EALNGEVQRL KLAIGETSHN ESDRSKMQSL NAEMFQQLNI SQLTQQRQSQ QNQNGTLSAK  420
PESNEL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00061084001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0808391e-166AY080839.1 Arabidopsis thaliana unknown protein (At4g38900) mRNA, complete cds.
GenBankAY1504351e-166AY150435.1 Arabidopsis thaliana unknown protein (At4g38900) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013698576.10.0transcription factor VIP1-like
RefseqXP_013698577.10.0transcription factor VIP1-like
RefseqXP_013698578.10.0transcription factor VIP1-like
RefseqXP_013698579.10.0transcription factor VIP1-like
RefseqXP_022555695.10.0transcription factor VIP1-like
RefseqXP_022555696.10.0transcription factor VIP1-like
RefseqXP_022555697.10.0transcription factor VIP1-like
RefseqXP_022555698.10.0transcription factor VIP1-like
TrEMBLA0A078FJ100.0A0A078FJ10_BRANA; BnaC03g60240D protein
STRINGBo3g149620.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM42242757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.31e-170bZIP family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]