PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00060487001
Common NameGSBRNA2T00060487001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 150aa    MW: 17079.5 Da    PI: 8.4873
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00060487001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_137.94e-125195549
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkel 49
                         ++ +r ++NRe+A+rsR+RKk + e L+e+v  L+++N++L ++l
  GSBRNA2T00060487001 51 RKRKRTMSNRESAKRSRLRKKRRFEDLTEEVNRLKSKNQELVNQL 95
                         577999*********************************998665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.2E-1147118IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.3E-104897No hitNo description
PROSITE profilePS5021710.7834998IPR004827Basic-leucine zipper domain
PfamPF077167.4E-94997IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.2E-95198No hitNo description
PROSITE patternPS0003605469IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 150 aa     Download sequence    Send to blast
MSSTSLEPVH ICFDDATITG DEITEILAFL QSDTSDNPSG SNELEAPVDE RKRKRTMSNR  60
ESAKRSRLRK KRRFEDLTEE VNRLKSKNQE LVNQLANVLS CGNAISKENN RLKTESVCLE  120
IRLLELYRFL VAMQSPISTR LNYISKLMI*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15272RKRTMSNRESAKRSRLRKKRR
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00060487001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022547447.11e-104basic leucine zipper 4
SwissprotQ9LQ651e-70BZIP4_ARATH; Basic leucine zipper 4
TrEMBLA0A078JKB81e-103A0A078JKB8_BRANA; BnaAnng23880D protein
TrEMBLA0A397XUE61e-103A0A397XUE6_BRACM; Uncharacterized protein
STRINGBra027855.1-P1e-103(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122322432
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G59530.11e-72basic leucine-zipper 4
Publications ? help Back to Top
  1. Guo YL, et al.
    Genome-wide comparison of nucleotide-binding site-leucine-rich repeat-encoding genes in Arabidopsis.
    Plant Physiol., 2011. 157(2): p. 757-69
    [PMID:21810963]
  2. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  3. Nowak K,Gaj MD
    Stress-related function of bHLH109 in somatic embryo induction in Arabidopsis.
    J. Plant Physiol., 2016. 193: p. 119-26
    [PMID:26973252]
  4. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  5. Ma H, et al.
    ZmbZIP4 Contributes to Stress Resistance in Maize by Regulating ABA Synthesis and Root Development.
    Plant Physiol., 2018. 178(2): p. 753-770
    [PMID:30126870]