PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00060242001
Common NameGSBRNA2T00060242001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 636aa    MW: 69092.9 Da    PI: 6.065
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00060242001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_140.84.7e-13187248263
                          XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                           + k+  r+++NRe+A+ sR+RKk+++eeL+ kvk++ +   +L  +++    e a+l+++ 
  GSBRNA2T00060242001 187 DDEKKKVRLIRNRESAQLSRLRKKQYVEELQGKVKTMNSTIAELNGKISYVMAENAALRQQM 248
                          56799******************************************999999999999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1704.5E-16179250No hitNo description
SMARTSM003382.4E-16186250IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.048188251IPR004827Basic-leucine zipper domain
PfamPF001701.6E-10189248IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.5E-12190248No hitNo description
CDDcd147041.35E-17191242No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 636 aa     Download sequence    Send to blast
MTESTFSIAN PPEMPDLNPN TLPDPEMISV PPLDPLFLSA SDPISDLSFF FNDENGDFAD  60
LDFSFDDSVD FVDFDLDAEP PVAISEELGS SGDQSPEAIA NHANLDSPEE KIVDRGLEDR  120
SDSVHSQVSS QGSKTSGGCD TLSSPENSSV SKSKSTSKRK KGDSGGDYRS FKYQKSDEKS  180
ASPVEEDDEK KKVRLIRNRE SAQLSRLRKK QYVEELQGKV KTMNSTIAEL NGKISYVMAE  240
NAALRQQMMA AAGGGAPPPM NPYMAAPPLP YQWMPYPPPP YPYGSQIPIP KLPLPSCSRP  300
KKGEGKSKLK KAASISFIGI MFFMFLFGTL VPFMNVDNGG DSGLAKYEGR RYYDEHRGKV  360
LMVGDGSDVR RESVCSGRDS CGGVEGRVGN SSEPLFASLY VPRNNGLVKI DGNLIIHSVL  420
ASEKAKKNIS ETIKSKEAEL TVPGVPVPDV RGNGAMLPHS SKALSSSGSP DGKRLHQWFH  480
EGGAGTLMDY SMCTEVFQFD ISPGAIVPSS VSNITREHLQ NVTTTRDKRM KNRRILEGLP  540
VSRLASELNI TEAQASKDAQ NKTFHGKANT KPTSSSMVVS VLLDPREVVD SETDRVMPSN  600
PKSLSRVFVV VLLDSVKYVT YSCVLPRSGL HLVAT*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator involved in ER stress responses. Functions as a stress sensor and transducer in ER stress signaling pathway. After proteolysis by SBT6.1 (S1P) and S2P, the N-terminal bZIP component is translocated to the nucleus, where it activates the expression and production of ER chaperones (PubMed:18156219, PubMed:18634751, PubMed:18849477, PubMed:20876872). Following ER stress, activates proteins involved in brassinosteroid (BR) signaling, which is required for stress acclimation and growth (PubMed:20876872). {ECO:0000269|PubMed:18156219, ECO:0000269|PubMed:18634751, ECO:0000269|PubMed:18849477, ECO:0000269|PubMed:20876872}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00060242001
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By heat shock. {ECO:0000269|PubMed:18849477}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3531171e-179AK353117.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-21-B04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009122597.10.0PREDICTED: bZIP transcription factor 28
SwissprotQ9SG860.0BZP28_ARATH; bZIP transcription factor 28
TrEMBLA0A078HET20.0A0A078HET2_BRANA; BnaA01g31420D protein
STRINGBra034147.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM143971822
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10800.11e-141bZIP family protein
Publications ? help Back to Top
  1. Deng Y,Srivastava R,Howell SH
    Protein kinase and ribonuclease domains of IRE1 confer stress tolerance, vegetative growth, and reproductive development in Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 2013. 110(48): p. 19633-8
    [PMID:24145452]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Nagashima Y,Iwata Y,Ashida M,Mishiba K,Koizumi N
    Exogenous salicylic acid activates two signaling arms of the unfolded protein response in Arabidopsis.
    Plant Cell Physiol., 2014. 55(10): p. 1772-8
    [PMID:25138441]
  4. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  5. Sun L,Zhang SS,Lu SJ,Liu JX
    Site-1 protease cleavage site is important for the ER stress-induced activation of membrane-associated transcription factor bZIP28 in Arabidopsis.
    Sci China Life Sci, 2015. 58(3): p. 270-5
    [PMID:25634523]
  6. Zhang L,Chen H,Brandizzi F,Verchot J,Wang A
    The UPR branch IRE1-bZIP60 in plants plays an essential role in viral infection and is complementary to the only UPR pathway in yeast.
    PLoS Genet., 2015. 11(4): p. e1005164
    [PMID:25875739]
  7. Ma ZX, et al.
    The THERMOSENSITIVE MALE STERILE 1 Interacts with the BiPs via DnaJ Domain and Stimulates Their ATPase Enzyme Activities in Arabidopsis.
    PLoS ONE, 2015. 10(7): p. e0132500
    [PMID:26186593]
  8. Sagor GH, et al.
    The polyamine spermine induces the unfolded protein response via the MAPK cascade in Arabidopsis.
    Front Plant Sci, 2015. 6: p. 687
    [PMID:26442007]
  9. Kørner CJ,Du X,Vollmer ME,Pajerowska-Mukhtar KM
    Endoplasmic Reticulum Stress Signaling in Plant Immunity--At the Crossroad of Life and Death.
    Int J Mol Sci, 2015. 16(11): p. 26582-98
    [PMID:26556351]
  10. Zeng Y, et al.
    Unique COPII component AtSar1a/AtSec23a pair is required for the distinct function of protein ER export in Arabidopsis thaliana.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(46): p. 14360-5
    [PMID:26578783]
  11. Meng Z,Ruberti C,Gong Z,Brandizzi F
    CPR5 modulates salicylic acid and the unfolded protein response to manage tradeoffs between plant growth and stress responses.
    Plant J., 2017. 89(3): p. 486-501
    [PMID:27747970]
  12. Nawkar GM, et al.
    HY5, a positive regulator of light signaling, negatively controls the unfolded protein response in Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(8): p. 2084-2089
    [PMID:28167764]
  13. Iwata Y, et al.
    Activation of the Arabidopsis membrane-bound transcription factor bZIP28 is mediated by site-2 protease, but not site-1 protease.
    Plant J., 2017. 91(3): p. 408-415
    [PMID:28407373]
  14. Zhang SS, et al.
    Tissue-Specific Transcriptomics Reveals an Important Role of the Unfolded Protein Response in Maintaining Fertility upon Heat Stress in Arabidopsis.
    Plant Cell, 2017. 29(5): p. 1007-1023
    [PMID:28442596]
  15. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  16. Kataoka R,Takahashi M,Suzuki N
    Coordination between bZIP28 and HSFA2 in the regulation of heat response signals in Arabidopsis.
    Plant Signal Behav, 2017. 12(11): p. e1376159
    [PMID:28873003]
  17. Ruberti C,Lai Y,Brandizzi F
    Recovery from temporary endoplasmic reticulum stress in plants relies on the tissue-specific and largely independent roles of bZIP28 and bZIP60, as well as an antagonizing function of BAX-Inhibitor 1 upon the pro-adaptive signaling mediated by bZIP28.
    Plant J., 2018. 93(1): p. 155-165
    [PMID:29124827]
  18. Kim JS,Yamaguchi-Shinozaki K,Shinozaki K
    ER-Anchored Transcription Factors bZIP17 and bZIP28 Regulate Root Elongation.
    Plant Physiol., 2018. 176(3): p. 2221-2230
    [PMID:29367234]