PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00060177001
Common NameGSBRNA2T00060177001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRAS
Protein Properties Length: 557aa    MW: 60610.6 Da    PI: 5.6662
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00060177001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS445.34.1e-1361915511374
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppset.seknsseelaalklfsevsP 89 
                          lv++L++cAeav+s++l+la+al++++  la +++ +m+++a+yf+eALa+r++r        l+p +t  +++ s++l++   f+e++P
  GSBRNA2T00060177001 191 LVHALMACAEAVQSSNLTLAEALVKQIGFLAVSQAGAMRKVATYFAEALARRIYR--------LSPPQTqIDHSLSDTLQM--HFYETCP 270
                          689****************************************************........444444043445555444..5****** PP

                 GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefn 179
                          +lkf+h+taNqaIlea+eg++rvH+iDf+++qGlQWpaL+qaLa R++gpps+R+Tg+g+p++++++ l+e+g +La++Ae+++v+fe++
  GSBRNA2T00060177001 271 YLKFAHFTANQAILEAFEGKKRVHVIDFSMNQGLQWPALMQALALREGGPPSFRLTGIGPPAADNSDHLHEVGCKLAQLAEAIHVEFEYR 360
                          ****************************************************************************************** PP

                 GRAS 180 vlvakrledleleeLrvkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysal 267
                           +va++l+dl+ ++L+++p   E++aVn+v++lh+ll +++ +e+    v  +vk+++P +++vveqe++hn++ Fl+rf+e+l+yys+l
  GSBRNA2T00060177001 361 GFVANSLADLDASMLELRPseTESVAVNSVFELHKLLGRPGGIEK----VFGVVKQIKPVIFTVVEQESNHNGPVFLDRFTESLHYYSTL 446
                          ******************99899******************9999....***************************************** PP

                 GRAS 268 fdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesg 356
                          fdsle      s++++++++++lg++i+n+vaceg +r+erhetl++W++r++++GF p++l+++a kqa++ll+ ++ ++gyrvee++g
  GSBRNA2T00060177001 447 FDSLEGA---PSSQDKVMSEVYLGKQICNLVACEGPDRVERHETLSQWSNRFGSSGFAPAHLGSNAFKQASTLLALFNgGEGYRVEENNG 533
                          ****999...79999*************************************************************************** PP

                 GRAS 357 slvlgWkdrpLvsvSaWr 374
                          +l+l W++rpL+++SaW+
  GSBRNA2T00060177001 534 CLMLSWHTRPLITTSAWK 551
                          *****************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011291.3E-3942115No hitNo description
PfamPF120419.4E-3342109IPR021914Transcriptional factor DELLA, N-terminal
PROSITE profilePS5098566.001165530IPR005202Transcription factor GRAS
PfamPF035141.4E-133191551IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0010218Biological Processresponse to far red light
GO:0042176Biological Processregulation of protein catabolic process
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 557 aa     Download sequence    Send to blast
MKRDLHQFQG PNHGTSIAGS STSSPAVFGK DKMMMVKEEE DDELLGVLGY KVRSSEMAEV  60
ALKLEQLETM MGNVQEDGLA HLATDTVHYN PAELYSWLDN MLTELNPPAA SGSSGDYDLK  120
AIPGSAICRG SNQFAVDSLN NKRLKPCSSP DSMVTSPSPA GVIGTTVTTT TASESTRPLI  180
LVDSQDNGVR LVHALMACAE AVQSSNLTLA EALVKQIGFL AVSQAGAMRK VATYFAEALA  240
RRIYRLSPPQ TQIDHSLSDT LQMHFYETCP YLKFAHFTAN QAILEAFEGK KRVHVIDFSM  300
NQGLQWPALM QALALREGGP PSFRLTGIGP PAADNSDHLH EVGCKLAQLA EAIHVEFEYR  360
GFVANSLADL DASMLELRPS ETESVAVNSV FELHKLLGRP GGIEKVFGVV KQIKPVIFTV  420
VEQESNHNGP VFLDRFTESL HYYSTLFDSL EGAPSSQDKV MSEVYLGKQI CNLVACEGPD  480
RVERHETLSQ WSNRFGSSGF APAHLGSNAF KQASTLLALF NGGEGYRVEE NNGCLMLSWH  540
TRPLITTSAW KLSAVH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-541915514375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.122640.0leaf| root| seed
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00611ChIP-seqTransfer from AT2G01570Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00060177001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY9285490.0AY928549.1 Brassica rapa DELLA protein (RGA1) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013598468.10.0PREDICTED: DELLA protein RGA1
SwissprotQ5BN230.0RGA1_BRACM; DELLA protein RGA1
TrEMBLA0A078HEN80.0A0A078HEN8_BRANA; BnaC07g20900D protein
STRINGBra024875.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM83728121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01570.10.0GRAS family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]