PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00058236001
Common NameGSBRNA2T00058236001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 494aa    MW: 56514.9 Da    PI: 8.3753
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00058236001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.44.1e-10422479562
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                          kr++r   NR +  rs +RK ++i eLe kv++L++e ++L  +   l+  +  l+++
  GSBRNA2T00058236001 422 KRAKRILVNRQSTARSKERKIQYIVELEHKVQTLQTEATTLSAQFTLLQRDMMGLTNQ 479
                          9*****************************************9999888777666666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5141911.5041259No hitNo description
PfamPF047822.5E-111114IPR006867Domain of unknown function DUF632
SMARTSM001757.0E-1087215No hitNo description
SuperFamilySSF525403.28E-15111216IPR027417P-loop containing nucleoside triphosphate hydrolase
PfamPF000714.5E-17112213IPR001806Small GTPase superfamily
Gene3DG3DSA:3.40.50.3007.1E-20112232IPR027417P-loop containing nucleoside triphosphate hydrolase
PRINTSPR004491.8E-5155168No hitNo description
PRINTSPR004491.8E-5190212No hitNo description
SMARTSM003385.5E-14418482IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.887420483IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.23E-10422478No hitNo description
PfamPF001702.2E-8422476IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.1E-9422479No hitNo description
CDDcd147031.78E-19423472No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007264Biological Processsmall GTPase mediated signal transduction
GO:0005622Cellular Componentintracellular
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005525Molecular FunctionGTP binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 494 aa     Download sequence    Send to blast
MWRLLAKYHH KQFQTRSKSC GHMVEKELRK LTQKVEEHIR TFRESLKESL KGYIDRHGSF  60
VSVLNEWLNK NTMEEDDQTE TEAPEIFRVC CKRLKETENV DGVKVLSTIK LFMAFTIAYY  120
RGSVGALLVY NNMTSHSRFE NATRWQRELR GHTDPNSVVI LISNKCELRG MVEIKTEETK  180
AFDKRESPYF MEMSVLDSTN VENAFSEGLT QIHKIVSKRR VDEPNKEGER GSGMELRFRS  240
LGFKQVKEER QRMRTEKLCK ELETKMNKND EVIFKASLNL EYIEALNSSE ADDNCKNGKD  300
DMGSCRASRT TNTNGSIDDT NQGESSSVKY KSDHDHNNNL SLGAGGGDIA PTSIHYMSVS  360
VDNCFMDKLF FGEESLNPPP SPHGTVSRKD DVAFSIEFKN AAKIKKIMAY DKLSEMAMTD  420
PKRAKRILVN RQSTARSKER KIQYIVELEH KVQTLQTEAT TLSAQFTLLQ RDMMGLTNQN  480
NEFKWSSNST SAS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5xr4_A9e-4711221987193Ras-related protein RABA1a
5xr4_B9e-4711221987193Ras-related protein RABA1a
5xr6_A9e-4711221987193Ras-related protein RABA1a
5xr6_B9e-4711221987193Ras-related protein RABA1a
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1434442ARSKERKIQ
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00058236001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013665568.20.0uncharacterized protein LOC106370037
TrEMBLA0A078HA010.0A0A078HA01_BRANA; BnaC03g59330D protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.35e-83bZIP family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]