PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00056245001
Common NameGSBRNA2T00056245001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CPP
Protein Properties Length: 287aa    MW: 31923.7 Da    PI: 8.2995
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00056245001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR29.61.4e-0936601640
                  TCR 16 kYCeCfaagkkCseeCkCedCkNke 40
                          YCeCfaag++C e C+C dC+Nk 
  GSBRNA2T00056245001 36 SYCECFAAGVYCIEPCSCIDCFNKP 60
                         7**********************96 PP

2TCR55.11.5e-17107145139
                  TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                          ++k+gCnCkks+ClkkYCeCf++g+ Cs +C+Ce+CkN 
  GSBRNA2T00056245001 107 RHKRGCNCKKSNCLKKYCECFQSGVGCSINCRCEGCKNA 145
                          589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5163431.52521147IPR005172CRC domain
SMARTSM011146.3E-52262IPR033467Tesmin/TSO1-like CXC domain
PfamPF036382.1E-63659IPR005172CRC domain
SMARTSM011142.4E-17107148IPR033467Tesmin/TSO1-like CXC domain
PfamPF036387.9E-13109145IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MLLDFLLIIV AIKIYVHNEN MSTNLGCVHN SFLSASYCEC FAAGVYCIEP CSCIDCFNKP  60
IHEDTVLATR KQIESRNPLA FAPKVIRISD SIMETSDDAS KTRASARHKR GCNCKKSNCL  120
KKYCECFQSG VGCSINCRCE GCKNAFGRKD ANIQEIEQNP SSDQPSTPLP PYRQLLIYCF  180
FYLQPFLSKN RLPRTQFFLG ADNDLTQSKN EKKPVETVTE EEPEVIPEIL SNTPITTIKA  240
ISPNSKRVSP PQLGSSESGS MLVKRSNGRK LIVRSIPAFP SLNPHQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-113714425120Protein lin-54 homolog
5fd3_B1e-113714425120Protein lin-54 homolog
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed at the first stage of pollen development in uninucleate microspores and bicellular pollen but not in tricellular and mature pollen. {ECO:0000269|PubMed:18057042}.
UniprotTISSUE SPECIFICITY: Ubiquitous but expressed mostly in flowers with highest levels in developing ovules and microspores. {ECO:0000269|PubMed:10769244, ECO:0000269|PubMed:10769245, ECO:0000269|PubMed:18057042}.
Functional Description ? help Back to Top
Source Description
UniProtProbable floral-specific cell division component, required for proper organ formation in flowers. Regulates the floral meristem cell division and the inflorescence meristem organization. Plays a role in development of both male and female reproductive tissues. {ECO:0000269|PubMed:10769244, ECO:0000269|PubMed:10769245, ECO:0000269|PubMed:9043081, ECO:0000269|PubMed:9725857}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00056245001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2040591e-105AF204059.1 Arabidopsis thaliana CXC domain protein TSO1 (TSO1) mRNA, complete cds.
GenBankAF2063241e-105AF206324.1 Arabidopsis thaliana putative DNA binding protein (tso1) mRNA, tso1-3 allele, complete cds.
GenBankAY0460191e-105AY046019.1 Arabidopsis thaliana putative DNA binding protein (At3g22780) mRNA, complete cds.
GenBankAY1426421e-105AY142642.1 Arabidopsis thaliana putative DNA binding protein (At3g22780) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013587689.11e-144PREDICTED: CRC domain-containing protein TSO1
RefseqXP_022557925.11e-144CRC domain-containing protein TSO1-like
SwissprotQ9LUI31e-137TSO1_ARATH; CRC domain-containing protein TSO1
TrEMBLA0A078H6N70.0A0A078H6N7_BRANA; BnaA01g24520D protein
TrEMBLA0A3P5ZAD20.0A0A3P5ZAD2_BRACM; Uncharacterized protein
STRINGBo5g094500.11e-144(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.11e-126Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Lu T,Dou Y,Zhang C
    Fuzzy clustering of CPP family in plants with evolution and interaction analyses.
    BMC Bioinformatics, 2013. 14 Suppl 13: p. S10
    [PMID:24268301]
  2. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  3. Xie W, et al.
    Exploring potential new floral organ morphogenesis genes of Arabidopsis thaliana using systems biology approach.
    Front Plant Sci, 2015. 6: p. 829
    [PMID:26528302]
  4. Wang W,Sijacic P,Xu P,Lian H,Liu Z
    Arabidopsis TSO1 and MYB3R1 form a regulatory module to coordinate cell proliferation with differentiation in shoot and root.
    Proc. Natl. Acad. Sci. U.S.A., 2018. 115(13): p. E3045-E3054
    [PMID:29535223]