PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00055763001
Common NameGSBRNA2T00055763001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 165aa    MW: 19801 Da    PI: 7.0044
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00055763001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_128.63.1e-0961116459
                          XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59 
                           kr rr+ +NRe+ArrsR RK+++i e +  v++L++ N  L +++ +l +  ++ 
  GSBRNA2T00055763001  61 EKRLRRMVSNRESARRSRMRKRKQIREKKMHVEQLTTSNYNLYNKVISLLERTPQI 116
                          59*************************************99998877776666555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003380.002158122IPR004827Basic-leucine zipper domain
PfamPF077163.0E-859109IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.4E-759111No hitNo description
PROSITE profilePS5021710.05960123IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.5E-862111No hitNo description
CDDcd147023.36E-1263113No hitNo description
PROSITE patternPS0003606580IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 165 aa     Download sequence    Send to blast
MEAEDQHPSH YFNLYEGDSS QNDHFNLQNP QNDHDHDHDQ DLHVHDHCTH PQASSVVIDQ  60
EKRLRRMVSN RESARRSRMR KRKQIREKKM HVEQLTTSNY NLYNKVISLL ERTPQILHEN  120
SQLEEKLSYF HQYFMEDRMV LPGNNIDCDI TRQYLRFCIN QLGK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17883MRKRKQ
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00055763001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2410040.0AC241004.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB026J02, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010522314.13e-33PREDICTED: basic leucine zipper 43
TrEMBLA0A078JN801e-118A0A078JN80_BRANA; BnaUnng01680D protein
STRINGBra005971.1-P8e-98(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17031811
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08141.14e-16basic leucine-zipper 75
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]