PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00055136001
Common NameGSBRNA2T00055136001, LOC106363106, LOC106365455, LOC106373884, LOC106413589
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WOX
Protein Properties Length: 276aa    MW: 31962 Da    PI: 6.7447
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00055136001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.71.3e-2044102356
                          --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHH CS
             Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakek 56 
                          +R+++t+eq+ +Le+++ + +r+p++++++++A+kl    +++ ++V++WFqN++ +ek
  GSBRNA2T00055136001  44 SRWNPTPEQTMVLEKVYSSgTRTPTTQQIQDIASKLqkygRIEGKNVFYWFQNHKSREK 102
                          7*****************99*************************************99 PP

2Wus_type_Homeobox108.63.7e-3543104364
    Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                          ++RW+PtpeQ ++Le++y+sG+rtP++++iq+i+++L++yG+ie+kNVfyWFQN+k+Re+ k
  GSBRNA2T00055136001  43 HSRWNPTPEQTMVLEKVYSSGTRTPTTQQIQDIASKLQKYGRIEGKNVFYWFQNHKSREKLK 104
                          68*********************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.09439104IPR001356Homeobox domain
SuperFamilySSF466891.97E-1240103IPR009057Homeodomain-like
SMARTSM003898.5E-541108IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.0E-944102IPR009057Homeodomain-like
PfamPF000464.0E-1844102IPR001356Homeobox domain
CDDcd000862.44E-545102No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MGYNKDLTSH TLAHHCNIND IRNDEQIIAG SEGKPKEREK YMHSRWNPTP EQTMVLEKVY  60
SSGTRTPTTQ QIQDIASKLQ KYGRIEGKNV FYWFQNHKSR EKLKRRRGDQ QGVTAINNVH  120
EESLNKDNAT ANKASSSVSR RRGDHRVIHT RTSLSSSPTH PQKNNVDDGK REHYETGVKD  180
EEATGQNQKN PIYTSEFKYH LKVASKPSQE ADQQYTLNDD DDDEEEEEET RKSRTLDLFP  240
VTENQETTGF AETNTKPNQL YCNYCYYYEF MPLMN*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00055136001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013658359.10.0PREDICTED: WUSCHEL-related homeobox 6-like
RefseqXP_013660339.10.0PREDICTED: WUSCHEL-related homeobox 6-like
RefseqXP_013669453.10.0PREDICTED: WUSCHEL-related homeobox 6-like
RefseqXP_013709792.10.0PREDICTED: WUSCHEL-related homeobox 6-like
TrEMBLA0A078HA420.0A0A078HA42_BRANA; BnaA09g45340D protein
STRINGBra026791.1-P1e-147(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM133691828
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01500.14e-42WOX family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]