PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00054985001
Common NameGSBRNA2T00054985001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Nin-like
Protein Properties Length: 762aa    MW: 85019.9 Da    PI: 6.0697
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00054985001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.56.2e-29502553152
               RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          aek+i++++l+++F++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  GSBRNA2T00054985001 502 AEKTITFDVLRQHFAGSLKDAAKNIGVCPTTLKRICRQHGIQRWPSRKIKKV 553
                          589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.075492573IPR003035RWP-RK domain
PfamPF020423.3E-25505553IPR003035RWP-RK domain
SuperFamilySSF542774.77E-22660755No hitNo description
PROSITE profilePS5174526.62670753IPR000270PB1 domain
SMARTSM006661.3E-25670753IPR000270PB1 domain
PfamPF005641.4E-18671752IPR000270PB1 domain
CDDcd064072.78E-39671751No hitNo description
Gene3DG3DSA:3.10.20.2409.8E-20671750No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 762 aa     Download sequence    Send to blast
MEDSLLQTEN TVMDTEFMDG LLLDGCWLET TDGSVSPFDP SSFKWPPTQD TSSICTSEVV  60
SQTYGQDCAS LDEFPWNKRW WIGPGGGGSS ITERLLWVPV NRGGKRVLTT REQPYSHDPT  120
CQRLANYREV SVNYHFSAEK DDSKALAGLP GRVFLGRLPE WTPDVRFFRS EEYPRVHHAQ  180
DCDVRGTLAI PVFEQGSKVC LGVIEVVMTT EMVKLAPELE SICRALQAVD LRSTEVQIPP  240
SLKGCDLSYK AALPEIRNLL RCACETHKLP LAQTWVSCLH QSKSGCRHND ENYIHCVSTI  300
DDACYLGDPT VREFHEACSE HHLLKGQGVA GQAFLTNGPC FSPDVSNYKK SEYPLSHHAN  360
IFGLHGSVAI RLRCIHTGSV DFVLEFFLPK DCGDVEEQRK ILNALSTIMA HVPRSLRIVT  420
DKELEDESEV IVTPKIEITS EHTKDWLHQS NNPENLGLIF DVGDKASDEF GLKRGFGYTR  480
DSNINESSTF SSKMAETKRT KAEKTITFDV LRQHFAGSLK DAAKNIGVCP TTLKRICRQH  540
GIQRWPSRKI KKVGHSLQKI QRVIDSVEGV SGLLPIGSFF ANFPNLASSQ EPSLQGKTSL  600
SPQPLQLSKS PVSPYSHSSS SSQCCSSETQ LNSDTTTTTT DVGGGVLTLS SLENIPQSTN  660
LSLSSLDNDF LRIKVSYGEE KIRFRMGNSR RLSDLLWEIG KRFSIEDMSR CDLKYLDEDN  720
EWVLLTCDED VEECVSVCST TRSHTIKLLL HVSSHCYNSW Q*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00054985001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893460.0AC189346.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB042N05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013727433.10.0protein NLP4-like
SwissprotQ9LE380.0NLP4_ARATH; Protein NLP4
TrEMBLA0A078H8260.0A0A078H826_BRANA; BnaC08g19370D protein
STRINGBo8g070310.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34612663
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]