PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00054404001
Common NameGSBRNA2T00054404001, LOC106361184
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CPP
Protein Properties Length: 574aa    MW: 61276.2 Da    PI: 7.6263
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00054404001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR44.92.3e-14119158141
                  TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                          ++kk+CnCk s+Clk+YCeCfaag++C+  C+C +C+N+ +
  GSBRNA2T00054404001 119 QKKKHCNCKLSRCLKLYCECFAAGTYCDG-CNCLNCFNNVD 158
                          589**************************.********986 PP

2TCR51.32.3e-16201240140
                  TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                          k++kgC+Ckks ClkkYCeCf+a++ Cse+C+C +CkN e
  GSBRNA2T00054404001 201 KHNKGCHCKKSGCLKKYCECFQANVLCSENCRCLGCKNFE 240
                          589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011143.7E-16119159IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163435.518120241IPR005172CRC domain
PfamPF036381.1E-10121156IPR005172CRC domain
SMARTSM011143.8E-19201242IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.4E-12204239IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 574 aa     Download sequence    Send to blast
MGEGGGGGGG GGGDFPPKKD GESDDSCFPA KKEATQLDFT GGSDEHYSES HTVVTPSVTP  60
PVTTTPSRLH PVARPALPVV TSQSQSQILN APISLPKPPE SPESRARPPI VEGRDGTPQK  120
KKHCNCKLSR CLKLYCECFA AGTYCDGCNC LNCFNNVDNE PARRDAVEAT LDRNPNAFRP  180
KIASSPHGVR DKKEEIVLLG KHNKGCHCKK SGCLKKYCEC FQANVLCSEN CRCLGCKNFE  240
GSEERQALFH GEHANNMAYL QQAANAAITG AVGSSGFAPF PAPKRRKGQD ISFNQATNDS  300
SMHRLGQFQQ ASNGRTSGPT STTSPANVSR AGGNSSAPSK FVYRSLLAEI IQPQDVKALC  360
SVLVAVAGET TKTLTDRRNE TEKRVEDQTE TSLASYNSQG NKTDGSQADG SKGDPLSPAT  420
LALMCDEQDS LFMVAAAEPN GSVDPGGCGT NSQGQSEIYA EKERVVLTKF RDCLTRLISY  480
ADFKESKCSY LARSHIQSPS TVPTVTVKTE NGIQQRPPVV NGASLTTTQP ALNKPQLVQP  540
TTTTDTSSSH HPHKPPALEE NKDTSESNKV YST*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A3e-3212125011132Protein lin-54 homolog
5fd3_B3e-3212125011132Protein lin-54 homolog
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous but expressed mostly in flowers. {ECO:0000269|PubMed:18057042}.
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00054404001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013656350.10.0protein tesmin/TSO1-like CXC 5
SwissprotQ9SZD10.0TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A078JL050.0A0A078JL05_BRANA; BnaA08g30730D protein
STRINGBra010348.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.10.0Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]