PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00053358001
Common NameGSBRNA2T00053358001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB_related
Protein Properties Length: 87aa    MW: 10317.9 Da    PI: 10.0144
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00053358001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding33.31.1e-102969345
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
      Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                         ++++eE++l+ +  k+ G + W++Ia +++ gRt++++  +w+
  GSBRNA2T00053358001 29 KMSEEEEDLISRMYKLVGDR-WELIAGRIP-GRTPEEIERYWL 69
                         789***************99.*********.***********7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007174.0E-82674IPR001005SANT/Myb domain
PfamPF002497.9E-102870IPR001005SANT/Myb domain
CDDcd001679.98E-72970No hitNo description
SuperFamilySSF466892.42E-83069IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-113169IPR009057Homeodomain-like
PROSITE profilePS500906.7713168IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 87 aa     Download sequence    Send to blast
MDRRRRKQSK AKASCSEAEV SSIEWETVKM SEEEEDLISR MYKLVGDRWE LIAGRIPGRT  60
PEEIERYWLM KHGFVFASKR REIVRK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2410331e-30AC241033.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB045E05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013640316.12e-55PREDICTED: transcription factor CPC-like isoform X1
RefseqXP_009142416.12e-55PREDICTED: transcription factor CPC-like isoform X1
SwissprotO220595e-50CPC_ARATH; Transcription factor CPC
TrEMBLA0A078JLS06e-56A0A078JLS0_BRANA; BnaA04g29720D protein
STRINGBra039283.1-P2e-52(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM32328194
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46410.18e-49MYB_related family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]