PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00051416001
Common NameGSBRNA2T00051416001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family TALE
Protein Properties Length: 637aa    MW: 69281.9 Da    PI: 7.0264
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00051416001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.41.4e-093543911954
                          HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
             Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                          Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  GSBRNA2T00051416001 354 FEHflHPYPKDSDKHMLAKQTGLTRSQVSNWFINARVR 391
                          554459******************************88 PP

2BELL123.68e-40213284172
                 BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                          erqe+q+kkakL s+l+eV++rY+qy++q+q+vissFe++ag+gsak+YtslAlk+iSr+FrcLk+aia+qi
  GSBRNA2T00051416001 213 ERQEIQMKKAKLSSMLHEVEQRYRQYHQQMQMVISSFEQAAGIGSAKLYTSLALKTISRQFRCLKEAIAGQI 284
                          79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005748.7E-76144282IPR006563POX domain
PfamPF075263.6E-47150281IPR006563POX domain
PROSITE profilePS5007112.26332395IPR001356Homeobox domain
SMARTSM003892.3E-9335399IPR001356Homeobox domain
CDDcd000864.11E-12335396No hitNo description
SuperFamilySSF466895.56E-17336402IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.6E-29338401IPR009057Homeodomain-like
PfamPF059202.6E-18352391IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 637 aa     Download sequence    Send to blast
MAAYFHGNPS EISAGTDGGL QTLILMNPTT YVQYTQQDDD SNNNNNSNNN ANNNNSFVFL  60
DSHAPPQNAS QQFVGIPLSG HEAASITAAD NISTPRAQRG LSLSLSSQQQ QQQQQHQTLH  120
HVGFGSGPGE DIRVGPGSTG SGVTNGIANL VSSKYLKAAQ ELLDEVVNAD SKDINTKSQL  180
FSSKKESSTG AGEGSGGGGE ASGKRTVELG TAERQEIQMK KAKLSSMLHE VEQRYRQYHQ  240
QMQMVISSFE QAAGIGSAKL YTSLALKTIS RQFRCLKEAI AGQIKAANKS LGEEDSVSGV  300
GRLEGSRLKF VDHHLRQQRA LQQLGMIQHP SNNAWRPQRG LPERAVSVLR AWLFEHFLHP  360
YPKDSDKHML AKQTGLTRSQ VSNWFINARV RLWKPMVEEM YTEEMKEQGK NMGSMEKTLN  420
MDQNNEDSAS KSTSNQEKSP MGGGGGADNY HMNPNHNGDL EGVTGMQGSP KRLRTSEETM  480
MQPINADFSS NEKLTMKILE ERQGLRSDGG YPFMGNFGQY QMDEMSRFEV AVSDQELLAQ  540
RYSGNNNGVS LTLGLPHCDS LSSTHHQGFM QTHHGIPIGR RVKIGEADDY GAAALNGGGG  600
SAATVHSSAA AAAAYNGMNI QNQKRYVAQL LPDFVA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A7e-17341398158Homeobox protein Meis1
4xrs_B7e-17341398158Homeobox protein Meis1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00051416001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2272720.0AK227272.1 Arabidopsis thaliana mRNA for putative homeodomain transcription factor, complete cds, clone: RAFL11-09-C20.
GenBankAY0721750.0AY072175.1 Arabidopsis thaliana putative homeodomain transcription factor (At2g35940) mRNA, complete cds.
GenBankAY0965480.0AY096548.1 Arabidopsis thaliana putative homeodomain transcription factor (At2g35940) mRNA, complete cds.
GenBankAY0998540.0AY099854.1 Arabidopsis thaliana putative homeodomain transcription factor (At2g35940) mRNA, complete cds.
GenBankBT0084220.0BT008422.1 Arabidopsis thaliana At2g35940 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013633564.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_013633565.10.0PREDICTED: BEL1-like homeodomain protein 1
SwissprotQ9SJ560.0BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLA0A078H3W30.0A0A078H3W3_BRANA; BnaC04g44970D protein
STRINGBo4g185820.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50082650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.30.0BEL1-like homeodomain 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]