PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00050394001
Common NameGSBRNA2T00050394001, LOC106450027
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRAS
Protein Properties Length: 727aa    MW: 82615.2 Da    PI: 6.7949
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00050394001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS363.43.3e-1113507231373
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                          l++lLl+cA+avs +d+++a+ lL  +++++s++gd ++Rla+yf++ L+arla++++++y al++++ts    ++ l+a+++++ v+P+
  GSBRNA2T00050394001 350 LRSLLLSCAQAVSVNDHRRAEGLLRLVRQHSSSYGDGTERLAHYFANSLEARLAGTGTQVYTALSSKKTS---AADMLKAYQTYVSVCPF 436
                          689***************************************************************9999...9**************** PP

                 GRAS  91 lkfshltaNqaIleavege..ervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpf 176
                           k++ + aN++I + v++   +++HiiDf+is+G+QW +L + La R++++ +lRiTg++ p+ g   ++ + etg+rLak++++++vpf
  GSBRNA2T00050394001 437 KKIGIVFANHTIQQLVKKTmpDTIHIIDFGISYGFQWHSLVHRLAWRRGSSCKLRITGIDLPQRGfrPANGVIETGHRLAKYCKKFNVPF 526
                          *******************99******************************************9999*********************** PP

                 GRAS 177 efnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysa 266
                          e+n+ +a+++e+++le+L++k+gE +aVn+ ++  +llde+v+++s+rd vL+l+++++P++++ +    ++n++ F++rf e l+++s+
  GSBRNA2T00050394001 527 EYNA-IAQKWETIKLEDLKLKEGEFVAVNSLFRFRNLLDETVAVDSPRDVVLRLIQKIKPNIFIPSILSGSYNAPFFVTRFREVLYHFSS 615
                          ****.7************************************************************************************ PP

                 GRAS 267 lfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveees 355
                          lfd+ +++l re+  r++ E+e+ grei+nvvaceg++r+er e++++W+ r+++aGF+++p++++ +++ +l++ k + s+++ v+++ 
  GSBRNA2T00050394001 616 LFDMCDTTLTREDPMRVVFEKEFYGREIMNVVACEGTARVERPESYKQWQGRMMRAGFRQLPVEKELVQKLRLMVDKEYkSKEFDVDQDG 705
                          ***************************************************************************9998899******** PP

                 GRAS 356 gslvlgWkdrpLvsvSaW 373
                          +++++gWk+r +++ S+W
  GSBRNA2T00050394001 706 NWFLQGWKGRLVYASSFW 723
                          ****************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098561.953324703IPR005202Transcription factor GRAS
PfamPF035141.1E-108350723IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 727 aa     Download sequence    Send to blast
MGSYSAGFPG SFDNFHYNYK IDFSNFGNGL YLDDQPFLRS PSPFPPLPLP PLHPPPHPEP  60
YSQQNLPPAA AAAEDADADD DCTDSVLQYI SQVLMEEDMD DKPCMFHDAL SLQAAERSLY  120
EALGEKYPDS TRPVQLSHSP DELSDITSSG YTSRTTTTTT TSSDWSFDSL ENSRPSWMQT  180
PIPKNFVFQS TPSTRSSPNS GRNTGIRSSS SNDLVSNMFK DSSWALQFKK GVEEASKFLP  240
KSTQLVIDVE NDHHYVPYRI TGEKYHWRED EHLPEERSKK QAAVYADDPE LSEMFDKILL  300
FGDPKENPKC ILNETSQKEP PKASPSPKGE TTTYPRGQKP TAYVQEIPDL RSLLLSCAQA  360
VSVNDHRRAE GLLRLVRQHS SSYGDGTERL AHYFANSLEA RLAGTGTQVY TALSSKKTSA  420
ADMLKAYQTY VSVCPFKKIG IVFANHTIQQ LVKKTMPDTI HIIDFGISYG FQWHSLVHRL  480
AWRRGSSCKL RITGIDLPQR GFRPANGVIE TGHRLAKYCK KFNVPFEYNA IAQKWETIKL  540
EDLKLKEGEF VAVNSLFRFR NLLDETVAVD SPRDVVLRLI QKIKPNIFIP SILSGSYNAP  600
FFVTRFREVL YHFSSLFDMC DTTLTREDPM RVVFEKEFYG REIMNVVACE GTARVERPES  660
YKQWQGRMMR AGFRQLPVEK ELVQKLRLMV DKEYKSKEFD VDQDGNWFLQ GWKGRLVYAS  720
SFWVSV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-433487233374GRAS family transcription factor containing p
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00050394001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013747132.10.0PREDICTED: scarecrow-like protein 33
RefseqXP_013747131.10.0PREDICTED: scarecrow-like protein 33
SwissprotP0C8830.0SCL33_ARATH; Scarecrow-like protein 33
TrEMBLA0A078H2V40.0A0A078H2V4_BRANA; BnaA04g16850D protein
STRINGBra035653.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35827189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.10.0GRAS family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]