PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00050347001
Common NameGSBRNA2T00050347001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WOX
Protein Properties Length: 235aa    MW: 27143.2 Da    PI: 9.5053
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00050347001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox629.1e-20766357
                         --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
             Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                         +R+++t+eql +Lee++++  r+p+a ++++++++l    +++ ++V++WFqN++a++++
  GSBRNA2T00050347001  7 TRWCPTPEQLMILEEMYRSgIRTPNAVQIQQITAHLafygRIEGKNVFYWFQNHKARDRQ 66
                         7*****************99*************************************996 PP

2Wus_type_Homeobox119.71.2e-38667364
    Wus_type_Homeobox  3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                          tRW+PtpeQ++iLee+y+sG+rtPn+ +iq+ita+L+ yG+ie+kNVfyWFQN+kaR+rqk
  GSBRNA2T00050347001  6 ATRWCPTPEQLMILEEMYRSGIRTPNAVQIQQITAHLAFYGRIEGKNVFYWFQNHKARDRQK 67
                         79***********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003890.0021471IPR001356Homeobox domain
CDDcd000864.25E-4767No hitNo description
PfamPF000461.7E-17766IPR001356Homeobox domain
SuperFamilySSF466896.84E-11767IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.5E-7866IPR009057Homeodomain-like
PROSITE profilePS500719.7661267IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MSPVAATRWC PTPEQLMILE EMYRSGIRTP NAVQIQQITA HLAFYGRIEG KNVFYWFQNH  60
KARDRQKLRK KLAKQLHQQQ HHLQLQLQHI QPNPISQPLS NIIDPHNHYH HHYNHHRPYD  120
HMSFACCSQP SPICLSHQAI GVEAQSKVLS EHYCNKSGRE DMLMQKPITG QNTSYGRDWM  180
MMMMDMGPRP SYPSSSSVPV PYCNMMMNSP KIPLKTLELF PISSINSKQD SSKL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00050347001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2513971e-105AY251397.1 Arabidopsis thaliana PRS/WOX3 protein mRNA, complete cds.
GenBankAB0589201e-105AB058920.1 Arabidopsis thaliana PRS mRNA for PRESSED FLOWER, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009140922.11e-177PREDICTED: WUSCHEL-related homeobox 3
SwissprotQ9SIB41e-110WOX3_ARATH; WUSCHEL-related homeobox 3
TrEMBLA0A078H1Q61e-177A0A078H1Q6_BRANA; BnaA04g16520D protein
TrEMBLM4F3N81e-177M4F3N8_BRARP; Uncharacterized protein
STRINGBra035688.1-P1e-176(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM74802642
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28610.13e-96WOX family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]