PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00048511001
Common NameGSBRNA2T00048511001, LOC106454896
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 190aa    MW: 21079 Da    PI: 6.4924
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00048511001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260140.84.6e-4481071100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +Ca+Ck+lrr+CakdC++apyfp ++p+kfa+vhk+FGasnv+k+l++lp ++r da++slv+eA+ar+rdPvyG+vg i+ lq+q++ql
  GSBRNA2T00048511001   8 PCASCKLLRRRCAKDCIFAPYFPPDDPHKFAIVHKVFGASNVSKMLQELPVHQRADAVNSLVFEANARVRDPVYGCVGAISYLQNQVSQL 97 
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          + +la++++e
  GSBRNA2T00048511001  98 QMQLAVAQAE 107
                          *****99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.8047108IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-438105IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
MGGPGSSPCA SCKLLRRRCA KDCIFAPYFP PDDPHKFAIV HKVFGASNVS KMLQELPVHQ  60
RADAVNSLVF EANARVRDPV YGCVGAISYL QNQVSQLQMQ LAVAQAEILC IQMQQEPNLQ  120
SHHQILELDQ DDKILLLHNN IDNCNNNSNN NLGYAMSSGQ FNSNFASPSS IMQMQMQMQD  180
PLKQESLWT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-4841096112LOB family transfactor Ramosa2.1
5ly0_B1e-4841096112LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed predominantly in roots, and at low levels in shoots, floral stems and open flowers. {ECO:0000269|PubMed:12068116}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00048511001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1643060.0AB164306.1 Arabidopsis thaliana ASL5 mRNA for ASYMMETRIC LEAVES2-like gene 5 protein, partial cds.
GenBankAB4738380.0AB473838.1 Arabidopsis thaliana ASL5 mRNA for ASYMMETRIC LEAVES2-like 5 protein, complete cds.
GenBankAY0869600.0AY086960.1 Arabidopsis thaliana clone 29970 mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009144327.11e-139PREDICTED: LOB domain-containing protein 12
RefseqXP_013752430.11e-139LOB domain-containing protein 12
SwissprotQ8LBW31e-111LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A078FCQ91e-138A0A078FCQ9_BRANA; BnaA05g12220D protein
TrEMBLA0A291LQZ21e-138A0A291LQZ2_BRARR; Transcription factor LBD12a
TrEMBLA0A397Z9R31e-138A0A397Z9R3_BRACM; Uncharacterized protein
TrEMBLM4DP941e-138M4DP94_BRARP; Uncharacterized protein
STRINGBra018335.1-P1e-138(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.11e-110LBD family protein
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]
  2. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]