PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00048431001
Common NameGSBRNA2T00048431001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CPP
Protein Properties Length: 749aa    MW: 82163.6 Da    PI: 7.829
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00048431001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR51.12.6e-16385423240
                  TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                          ++k+CnCkkskClk+YCeCfaag++C e C+C dC+N+ 
  GSBRNA2T00048431001 385 SCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCVDCFNRP 423
                          689**********************************75 PP

2TCR52.68.9e-17470509140
                  TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                          ++k+gCnCkks+ClkkYCeCf++g+ Cs +C+Ce+CkN  
  GSBRNA2T00048431001 470 RHKRGCNCKKSNCLKKYCECFQSGVGCSINCRCEGCKNAF 509
                          589***********************************75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011145.4E-19384425IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.515385510IPR005172CRC domain
PfamPF036386.4E-12387422IPR005172CRC domain
SMARTSM011145.7E-17470511IPR033467Tesmin/TSO1-like CXC domain
PfamPF036382.7E-12472508IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 749 aa     Download sequence    Send to blast
MDNSQKKKIE TPTPKSKFED SPVFNYINNL SPIEAVRSIP TVQTFNSLSF TSPPPVFTSP  60
HASFHRESRF FRCHNSVERS KALESLDRSV STQEVVVASG EVDLNKEATL EDQEDETSCD  120
RVDSPGPGDI VTQVLLDPSG GAPQGEDDGS SSQDVSVGLR KILDAQKESG TPRLMADADE  180
LLVFRSPNDS EAFGCLVDKI SSSERRFCAG VKLTKHRDIT KDVPANDNQP LAVVPNQLVS  240
NLHRGSMRRR CLDFEVLGKR KKDIADDDQL AVGDNKAESS SKCVVPGIGL HLNAIAMASR  300
GIKINTIHED SASVEIQKSF LGSATPVQSQ DIMRETLDQA ESEPGKGLAV EEETPKPLVF  360
EELNQDSLQK KKQVRKVEEP GEGDSCKRCN CKKSKCLKLY CECFAAGVYC IEPCSCVDCF  420
NRPIHEDTVL ATRKQIESRN PLAFAPKVIR NSDSIMETSD DASKTPASAR HKRGCNCKKS  480
NCLKKYCECF QSGVGCSINC RCEGCKNAFG KKDAYLLAIM ESKQEEDLSK IQQNSDLSKE  540
VEQNHPSSDQ PSTPLPPYRH MVVHQPFLSK NRLPPTQFFL GAGSSSFRKP DGDLAQARIE  600
KKPLETVTQD KTEIMPEILS NTPITTVKAI SPNSKRVSPP HIGSSESGSI LGKRTNGRKL  660
ILRAQPLQNA QSSFAFPAAS SAPQQSVTSN QPAKHVKKAS RGRPLKIRKI ENIPSGSGTF  720
WSPFTDRSFE VFGSRVYDRS ATDSQPPQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-1638950714120Protein lin-54 homolog
5fd3_B2e-1638950714120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1247261RRRCLDFEVLGKRKK
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed at the first stage of pollen development in uninucleate microspores and bicellular pollen but not in tricellular and mature pollen. {ECO:0000269|PubMed:18057042}.
UniprotTISSUE SPECIFICITY: Ubiquitous but expressed mostly in flowers with highest levels in developing ovules and microspores. {ECO:0000269|PubMed:10769244, ECO:0000269|PubMed:10769245, ECO:0000269|PubMed:18057042}.
Functional Description ? help Back to Top
Source Description
UniProtProbable floral-specific cell division component, required for proper organ formation in flowers. Regulates the floral meristem cell division and the inflorescence meristem organization. Plays a role in development of both male and female reproductive tissues. {ECO:0000269|PubMed:10769244, ECO:0000269|PubMed:10769245, ECO:0000269|PubMed:9043081, ECO:0000269|PubMed:9725857}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00048431001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009145268.10.0PREDICTED: CRC domain-containing protein TSO1
SwissprotQ9LUI30.0TSO1_ARATH; CRC domain-containing protein TSO1
TrEMBLA0A078FCI80.0A0A078FCI8_BRANA; BnaA05g16930D protein
STRINGBra033919.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.10.0Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Lu T,Dou Y,Zhang C
    Fuzzy clustering of CPP family in plants with evolution and interaction analyses.
    BMC Bioinformatics, 2013. 14 Suppl 13: p. S10
    [PMID:24268301]
  2. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  3. Xie W, et al.
    Exploring potential new floral organ morphogenesis genes of Arabidopsis thaliana using systems biology approach.
    Front Plant Sci, 2015. 6: p. 829
    [PMID:26528302]
  4. Wang W,Sijacic P,Xu P,Lian H,Liu Z
    Arabidopsis TSO1 and MYB3R1 form a regulatory module to coordinate cell proliferation with differentiation in shoot and root.
    Proc. Natl. Acad. Sci. U.S.A., 2018. 115(13): p. E3045-E3054
    [PMID:29535223]