PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00048430001
Common NameGSBRNA2T00048430001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CPP
Protein Properties Length: 575aa    MW: 62932 Da    PI: 8.0118
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00048430001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR49.86.6e-16301339240
                  TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                          ++k+CnCk+skClk+YCeCfaag++C   C+C dC Nk 
  GSBRNA2T00048430001 301 SCKRCNCKRSKCLKLYCECFAAGVYCIGPCSCVDCLNKP 339
                          689**********************************96 PP

2TCR52.41.1e-16387425139
                  TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                          ++k+gCnCkks+ClkkYCeC+++g+ Cs +C+Ce+CkN 
  GSBRNA2T00048430001 387 RHKRGCNCKKSNCLKKYCECYQSGVGCSINCRCEGCKNA 425
                          589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011146.7E-17300341IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.484301427IPR005172CRC domain
PfamPF036389.9E-12303338IPR005172CRC domain
SMARTSM011144.2E-17387428IPR033467Tesmin/TSO1-like CXC domain
PfamPF036385.2E-12389425IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 575 aa     Download sequence    Send to blast
MDTPPKNVTQ IENPISKLKL ENSPVFNYIN SLSPIKPVRS LPIAQTFGSL SYSSPPSVFA  60
SPHVSSHKGS RFKSDHNHVP ASVGEEEALH ETEPPQILQN ECTTTTPPRG ETDLLKMCDG  120
NVKQKSETPD WDAMISDSSD ILIFDSMNDS EASTCFLERP SDSKTRSLGV AKSTLEPVIN  180
SNDDLRRGGR RRCLDFEQTS VASSSRCVVP SIGLHFNAIA LSSKDNNAGN EYPLSGNTEL  240
GLQGSITPVL NSQDNVRENE TREDAGQGVE ECPKSLALVE LNQSSPKKKR QFGQAGEGES  300
SCKRCNCKRS KCLKLYCECF AAGVYCIGPC SCVDCLNKPI HEDTVMATRK QIESRNPLAF  360
APKVIRNSDS IMEVGDDAKS KTPASARHKR GCNCKKSNCL KKYCECYQSG VGCSINCRCE  420
GCKNAFGRKD VSAGSSFTSM DKENETSSRG RTEKQPSTPM PLRQPLAQLP ISSNNMLLTH  480
QHLHGASGSS LHMSQSFRRQ DMSLMSHSKI GTITEERAEN IENLIESPMT NMINAVSPNS  540
KRVSLPMELS PWRRNGGRKL LLSIPTFPSL TPHH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A5e-1730342412120Protein lin-54 homolog
5fd3_B5e-1730342412120Protein lin-54 homolog
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous but expressed mostly in flowers and at significant levels in leaves. Detected with highest levels in developing ovules and microspores, and in petals. {ECO:0000269|PubMed:10769245, ECO:0000269|PubMed:18057042}.
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00048430001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018514565.10.0PREDICTED: protein tesmin/TSO1-like CXC 3
SwissprotQ8L5480.0TCX3_ARATH; Protein tesmin/TSO1-like CXC 3
TrEMBLA0A078FF020.0A0A078FF02_BRANA; BnaA05g16940D protein
STRINGBra033920.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22760.10.0Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]