PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00045162001
Common NameGSBRNA2T00045162001, LOC106429273
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family B3
Protein Properties Length: 258aa    MW: 28858.1 Da    PI: 8.5859
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00045162001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B348.12e-1519113199
                          EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
                   B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                          ffk+l  +d +++++  +p++f ++ + k + + ++tl+  +g sW v+l+ +  ++  + +kGW +F ++n+L +++f++F+ +g+++ 
  GSBRNA2T00045162001  19 FFKILADEDLSSESMRLIPNEFWRSSECK-NLPPKVTLKVAWGSSWPVNLS-TFMGCYLMERKGWDKFLNDNHLGDNEFLTFTNEGNNCI 106
                          99*********************998544.56779***************4.3333457778*********************6666665 PP

                          ..EEEEE-S CS
                   B3  91 elvvkvfrk 99 
                            +v +f+k
  GSBRNA2T00045162001 107 --TVDIFQK 113
                          ..8888876 PP

2B352.31e-161732521196
                          HHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
                   B3  11 lksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                          + + +l++p +fa+eh+ k  + ++ ++ d++g+ Wev +    + g+ ++++GW+  ++  gL +gD+++F+l++   +e+v+ v
  GSBRNA2T00045162001 173 SHLTLLSIPVTFAKEHMPK-VR-TKFVIHDPKGKPWEVVY--VPSNGSKLFSSGWRFLANGYGLAVGDVCTFRLVRP--KEMVLEV 252
                          445679**********644.33.58***************..9999999************************9874..3345555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.109.4E-1715115IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.35E-1617118IPR015300DNA-binding pseudobarrel domain
CDDcd100171.65E-1318111No hitNo description
PROSITE profilePS5086312.44919114IPR003340B3 DNA binding domain
SMARTSM010191.4E-1319114IPR003340B3 DNA binding domain
PfamPF023627.2E-1419113IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.7E-20157254IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.08E-21159254IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.929163256IPR003340B3 DNA binding domain
CDDcd100176.21E-14166253No hitNo description
SMARTSM010191.4E-14166256IPR003340B3 DNA binding domain
PfamPF023629.2E-14171249IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MARNIAFGRI QEDMNKTSFF KILADEDLSS ESMRLIPNEF WRSSECKNLP PKVTLKVAWG  60
SSWPVNLSTF MGCYLMERKG WDKFLNDNHL GDNEFLTFTN EGNNCITVDI FQKNCVEILK  120
PLNTSSSNVK NEEMSCVDPV IAESKKQKVD SNVYGASSSS SSAATFSLTI KKSHLTLLSI  180
PVTFAKEHMP KVRTKFVIHD PKGKPWEVVY VPSNGSKLFS SGWRFLANGY GLAVGDVCTF  240
RLVRPKEMVL EVLHASP*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.186140.0seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00045162001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013725469.10.0PREDICTED: B3 domain-containing protein At5g18000-like
TrEMBLA0A078H0V80.0A0A078H0V8_BRANA; BnaA04g25590D protein
STRINGBra037663.1-P1e-179(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56521135
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35310.11e-51B3 family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]