PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00044464001
Common NameGSBRNA2T00015364001, GSBRNA2T00044464001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WOX
Protein Properties Length: 290aa    MW: 31778.6 Da    PI: 6.9934
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00044464001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox49.38.4e-163191257
                         T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
             Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                         r+R+++++eq+ +Le+ F++   +p +ee  ++ k l     + +++V++WFqNrR + ++
  GSBRNA2T00044464001 31 RSRWSPKPEQILILESIFNSgMVNPPKEETVRIRKMLekfgAVGDANVFYWFQNRRSRSRR 91
                         89*****************99*************************************997 PP

2Wus_type_Homeobox107.48.7e-353093265
    Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                         +r+RW+P+peQi iLe++++sG+++P+kee+ ri+++Le++G+++d+NVfyWFQNr++R+r++q
  GSBRNA2T00044464001 30 VRSRWSPKPEQILILESIFNSGMVNPPKEETVRIRKMLEKFGAVGDANVFYWFQNRRSRSRRRQ 93
                         689***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.28E-142298IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.8E-92598IPR009057Homeodomain-like
PROSITE profilePS5007111.5482792IPR001356Homeobox domain
SMARTSM003892.1E-62996IPR001356Homeobox domain
PfamPF000461.4E-133191IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MDQEQTQHSP TGHSHSPSSP ASGSTSTETV RSRWSPKPEQ ILILESIFNS GMVNPPKEET  60
VRIRKMLEKF GAVGDANVFY WFQNRRSRSR RRQRQLQAAA AAAAVTTNTC DQTMMVNTSL  120
PQYSGADLGF GGCSTSSNYL YASSSTSSYG GGCDNHINNG MENLLAMSGQ MGYHEASQHH  180
YQHHSSNLSP MMCPSDQSSS YDHYQQGKQN SLFACLFLLF KLKKIPILGL TVFINGVPTE  240
VTSGGIDMKA MFGEDLVLVH SSGVPLPTDE FGFLMHSLQH GEAYFLVIF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00044464001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2514020.0AY251402.1 Arabidopsis thaliana WOX11 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013630409.11e-156PREDICTED: WUSCHEL-related homeobox 11 isoform X3
RefseqXP_013729370.11e-156PREDICTED: WUSCHEL-related homeobox 11 isoform X2
SwissprotQ6X7J31e-143WOX11_ARATH; WUSCHEL-related homeobox 11
TrEMBLA0A078G8Y70.0A0A078G8Y7_BRANA; BnaA01g34040D protein
STRINGBra036446.1-P1e-151(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28192768
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03660.11e-111WUSCHEL related homeobox 11
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]