PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00043985001
Common NameGSBRNA2T00043985001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family M-type_MADS
Protein Properties Length: 155aa    MW: 17904.6 Da    PI: 8.3176
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00043985001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF31.13e-101151343
                         --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
               SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                         i+n+s r+  +   + g+ KK  E+ vLCd++++ +i+s+ 
  GSBRNA2T00043985001 11 ISNDSVRKRALKHKKRGLTKKLDEIKVLCDIDACAVIYSPF 51
                         9**************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554552.62E-18182IPR002100Transcription factor, MADS-box
SMARTSM004323.5E-11160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006613.456161IPR002100Transcription factor, MADS-box
CDDcd002661.53E-19285No hitNo description
PfamPF003198.1E-91151IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MTRKKVNLAY ISNDSVRKRA LKHKKRGLTK KLDEIKVLCD IDACAVIYSP FNSTPEIWPP  60
NSEVHKVIEK FKILAEEEQT EASVNHEEFL TQTITKDEKK VKRLTEDNID KFMKELMYAC  120
LNGNLGDLAM DNSARGNLCE FIDDYLKKLY HHRT*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00043985001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009144110.14e-83PREDICTED: agamous-like MADS-box protein AGL80
TrEMBLA0A078JHV11e-110A0A078JHV1_BRANA; BnaA05g34910D protein
STRINGBra005166.1-P1e-82(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28700.13e-59AGAMOUS-like 46
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]