PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00043627001
Common NameGSBRNA2T00043627001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CPP
Protein Properties Length: 648aa    MW: 71228.6 Da    PI: 5.4535
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00043627001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.73.7e-16360398240
                  TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                          ++k+CnCkkskClk+YCeCfaag++C e C+C dC+Nk 
  GSBRNA2T00043627001 360 SCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCIDCFNKP 398
                          689**********************************96 PP

2TCR52.69e-17445483139
                  TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                          ++k+gCnCkks+ClkkYCeCf+ g+ Cs +C+Ce+CkN 
  GSBRNA2T00043627001 445 RHKRGCNCKKSNCLKKYCECFQGGVGCSINCRCEGCKNA 483
                          589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.3E-19359400IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.245360485IPR005172CRC domain
PfamPF036386.1E-12362397IPR005172CRC domain
SMARTSM011142.1E-17445486IPR033467Tesmin/TSO1-like CXC domain
PfamPF036383.8E-12447483IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 648 aa     Download sequence    Send to blast
MDTPQKSITQ IETPVSKSRF EDSPVFNYIN SLSPIRPVKS IPNPHQFSTL NFTSPPSVFT  60
SPHLTSSHKE SRFFKTHHPS PDPTILVQES PDDSKSNEES AAEADATTEF NIDASTEMEQ  120
PQIVKYDVKE TNLDETTDLS LVPYASPPRE DNGEDAPGME MHDNVQGKNE TPDWDRLIAD  180
SSEFLIFSSP NDSEAFRCLM MQRASPSQAP SVMMPTMQPG SINEPESSNA SPYGAVSVLH  240
RGIRRRCLDF EMPGNKQTSS ENNTAACGSS SRCVVPSIGL HLNALLMSTK DCKTNNTTHD  300
YSCSEKYQVG LQGSSSTLQE TLDQTETETR EDVTVEPTLE ELHLSSPKKK RQLEAGEGES  360
CKRCNCKKSK CLKLYCECFA AGVYCIEPCS CIDCFNKPIH EDTVLATRKQ IESRNPLAFA  420
PKVIKSSDLV LETGDDASKT PASARHKRGC NCKKSNCLKK YCECFQGGVG CSINCRCEGC  480
KNAFGRKDGS AIVDMEAEQE EENETSGKNR RAKNQENTEV YLMRKEESSA LPATPMSVYR  540
QQLVQLKNMM PPPQSVLGGG SSSSGMFNSQ YTRKPEMKSL ETVAEDGAEE MPEILSHSSI  600
DNINAVSPNG KRVSPPHMDS SSSGRRSGGR KLILQSIPTF PSLTPQH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-1636448214120Protein lin-54 homolog
5fd3_B1e-1636448214120Protein lin-54 homolog
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed at the late stage of pollen development in tricellular and mature pollen. {ECO:0000269|PubMed:18057042}.
UniprotTISSUE SPECIFICITY: Ubiquitous but expressed mostly in all the aerial organs with highest expression in flowers. {ECO:0000269|PubMed:10769245, ECO:0000269|PubMed:18057042}.
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00433DAPTransfer from AT4G14770Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00043627001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009148228.10.0PREDICTED: protein tesmin/TSO1-like CXC 2
SwissprotF4JIF50.0TCX2_ARATH; Protein tesmin/TSO1-like CXC 2
TrEMBLA0A078GTH90.0A0A078GTH9_BRANA; BnaA01g18960D protein
STRINGBra036900.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.10.0TESMIN/TSO1-like CXC 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]