PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00043201001
Common NameGSBRNA2T00043201001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WOX
Protein Properties Length: 204aa    MW: 22850.2 Da    PI: 5.3417
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00043201001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.19.7e-2178138257
                          T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
             Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                          r+R+t+t++ql++Le+ +e+ + +p++++++e+A++l    ++te++V++WFqNrRa+ k+
  GSBRNA2T00043201001  78 RNRWTPTSTQLQILESIYEEkSGTPNRRRIREIAAELsehgQITETNVYNWFQNRRARSKR 138
                          89*****************9899************************************97 PP

2Wus_type_Homeobox971.5e-3177140265
    Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                          +r+RWtPt++Q++iLe++y++   tPn+++i++i+aeL+e+G+i+++NV++WFQNr+aR+++kq
  GSBRNA2T00043201001  77 TRNRWTPTSTQLQILESIYEEKSGTPNRRRIREIAAELSEHGQITETNVYNWFQNRRARSKRKQ 140
                          689***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-1671143IPR009057Homeodomain-like
PROSITE profilePS5007115.04674139IPR001356Homeobox domain
SuperFamilySSF466891.37E-1876143IPR009057Homeodomain-like
SMARTSM003893.0E-1476143IPR001356Homeobox domain
CDDcd000866.36E-1578140No hitNo description
PfamPF000461.9E-1878138IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MERENQNGAY VGRGVMTEEQ METLRKQIAV YSVICEQLAL LHNSLSSFHP LSSGITPNGD  60
GYFNPMVASS SAQRISTRNR WTPTSTQLQI LESIYEEKSG TPNRRRIREI AAELSEHGQI  120
TETNVYNWFQ NRRARSKRKQ PQTIATTDQA EDAAVTTDEK RSCGDSGGFE SYEHILFPSP  180
DLGIEHLLSR GELSGDFNSY TID*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1131139RRARSKRKQ
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00043201001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1892470.0AC189247.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB018K09, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009149550.11e-151PREDICTED: WUSCHEL-related homeobox 14-like
SwissprotQ9LM841e-115WOX14_ARATH; WUSCHEL-related homeobox 14
TrEMBLA0A078GVI81e-152A0A078GVI8_BRANA; BnaA06g14590D protein
STRINGBra025839.1-P1e-150(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122111732
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20700.11e-117WUSCHEL related homeobox 14
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]