PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00043025001
Common NameGSBRNA2T00043025001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 463aa    MW: 51136.8 Da    PI: 5.4713
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00043025001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_122.81.9e-07142204163
                          XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                          e+e +r rr   NRe+Ar   +R++a +eeL +k++ L  eN+ L+ e +   ke ++l++ +
  GSBRNA2T00043025001 142 EREERRIRRILANRESARQTIRRRQAMCEELSKKAADLAYENENLRREKDWALKEFQSLETIN 204
                          78899*******************************************999999999988766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF001703.6E-7142204IPR004827Basic-leucine zipper domain
SMARTSM003381.9E-8142206IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.933144207IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.38E-6146201No hitNo description
Gene3DG3DSA:1.20.5.1703.0E-6146212No hitNo description
CDDcd147025.15E-12152198No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 463 aa     Download sequence    Send to blast
MELEPISSCC STSSSGEDAA ANMTELEAAE ALADLAQLAV MREQVFESAA SWGSKGKRVR  60
KRVKTESPPA DSETLPTPDL AEERAVKEEG VEEVEPISRE VTEVPVKTET NGETPKPNLA  120
STLRCNRPSG CGRSRQNLSE AEREERRIRR ILANRESARQ TIRRRQAMCE ELSKKAADLA  180
YENENLRREK DWALKEFQSL ETINKHLKEQ VAKSVKPETK EPEESPKASQ VEMSTSSTTP  240
FYFYNQNPYQ LFCWPHVTQP SNPMVSPFES QNGFTAPFTA TGGASAKAMT SQENGNPGGD  300
DNGQKTHFYV VPCPWFLPAP SDQSNGVPFA FEEPQRVVSS NGHHTDDSST KPVEVTKTLT  360
GIKEENSGST ETRPLYDLNE SATEVLSEEG DGFPVTTQQQ AFSFKREDVS DSPNGVTPPG  420
HRVLMSLPGK KQGSLAAAEA RKRRKELTKL KNLHGRQCRM QV*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1440445RKRRKE
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00043025001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893560.0AC189356.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB043O20, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013641885.10.0uncharacterized protein BNAA06G13700D
TrEMBLA0A078GV670.0A0A078GV67_BRANA; BnaA06g13700D protein
STRINGBra025743.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM112112428
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19490.11e-177bZIP family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]