PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00042826001
Common NameGSBRNA2T00042826001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRAS
Protein Properties Length: 543aa    MW: 59628.6 Da    PI: 5.5842
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00042826001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS380.71.8e-1162045221333
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppset.seknsseelaalklfsevsP 89 
                          lv++L++cAea++++dl+ a+al++++  la +++ +m+++a+yf+eALa+r++r        l+p +t  +++ s++l++   f+e++P
  GSBRNA2T00042826001 204 LVHALMACAEAIQNNDLSIAEALVKQIGFLAVSQAGAMRKVATYFAEALARRIYR--------LSPPQTqIDHSLSDTLQM--HFYETCP 283
                          689****************************************************........444444043445555444..5****** PP

                 GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefn 179
                          +lkf+h+taNqaIlea+eg++rvH+iDf+++qGlQWpaL+qaLa R++gpp +R+Tg+g+p++++++ l+e+g +La++Ae+++v+fe++
  GSBRNA2T00042826001 284 YLKFAHFTANQAILEAFEGKKRVHVIDFSMNQGLQWPALMQALALREGGPPVFRLTGIGPPAADNSDHLHEVGCKLAQLAEAIHVEFEYR 373
                          ****************************************************************************************** PP

                 GRAS 180 vlvakrledleleeLrvkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysal 267
                           +va++l+dl+ ++L+++p   Ea+aVn+v++lh+ll +++ +e+    vL +vk+++P +++vveqe++hn++ Fl+rf+e+l+yys+l
  GSBRNA2T00042826001 374 GFVANSLADLDASMLELRPseIEAVAVNSVFELHKLLGRTGGIEK----VLGVVKQIKPVIFTVVEQESNHNGPVFLDRFTESLHYYSTL 459
                          ******************98889**************99999999....***************************************** PP

                 GRAS 268 fdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplseka 333
                          fdsle      s++++++++++lg++i+n+vaceg +r+erhetl++W +r++++GF p++l++++
  GSBRNA2T00042826001 460 FDSLEGV---PSSQDKVMSEVYLGKQICNLVACEGPDRVERHETLSQWANRFGTSGFAPAHLGKRV 522
                          ****998...69999**********************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011292.0E-3945118No hitNo description
PfamPF120414.8E-3545112IPR021914Transcriptional factor DELLA, N-terminal
PROSITE profilePS5098560.919178542IPR005202Transcription factor GRAS
PfamPF035146.1E-114204522IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 543 aa     Download sequence    Send to blast
MKRDLHQFQG PPDTRFPNHG TANTGSSSKD KMMKVKEEED GGNMDELLAV LGYKVRSSEM  60
AEVALKLEQL ETMMGNVQED GLSNLATDTV HYNPSELYSW LDNMLTEFNP PPPEINNSFL  120
AGAGGSDYDL KAIPGNAIYA RSNQFAIDSS SSSNQAGDNS QSTKRLKSCS SPDSLVTGTT  180
VTTTTTESTR SMVLVDSQEN GVRLVHALMA CAEAIQNNDL SIAEALVKQI GFLAVSQAGA  240
MRKVATYFAE ALARRIYRLS PPQTQIDHSL SDTLQMHFYE TCPYLKFAHF TANQAILEAF  300
EGKKRVHVID FSMNQGLQWP ALMQALALRE GGPPVFRLTG IGPPAADNSD HLHEVGCKLA  360
QLAEAIHVEF EYRGFVANSL ADLDASMLEL RPSEIEAVAV NSVFELHKLL GRTGGIEKVL  420
GVVKQIKPVI FTVVEQESNH NGPVFLDRFT ESLHYYSTLF DSLEGVPSSQ DKVMSEVYLG  480
KQICNLVACE GPDRVERHET LSQWANRFGT SGFAPAHLGK RVCFWLCLTA AKVILWRRIM  540
GV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-452045364341GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.122640.0leaf| root| seed
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB3319190.0AB331919.1 Brassica oleracea var. italica BoGAI mRNA for GRAS family transcription factor, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013701756.10.0PREDICTED: DELLA protein RGA2-like
SwissprotQ5BN220.0RGA2_BRACM; DELLA protein RGA2
TrEMBLA0A078JHF50.0A0A078JHF5_BRANA; BnaC09g52270D protein
STRINGBra017443.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM83728121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01570.10.0GRAS family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]