PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00042488001
Common NameGSBRNA2T00042488001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family B3
Protein Properties Length: 294aa    MW: 33373.4 Da    PI: 9.5261
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00042488001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3512.7e-1619110196
                          EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTE.EEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
                   B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgr.yvltkGWkeFvkangLkegDfvvFkldgrse 89 
                          f k++  +d +++++ ++p + +++  + ++   ++++  ++g sWev +  +k+++  y+ ++GW++Fv++n L  ++fv+F+++g+++
  GSBRNA2T00042488001  19 FSKTFACADLSSECMRTFPFDLMKSLPK-ENLANKMVIIAKWGSSWEVDI--SKNPRFyYMEKSGWNQFVRDNALGKNEFVTFTHKGSMC 105
                          6778888899999999999999988853.457779***************..******566669**********************9999 PP

                          E..EEEE CS
                   B3  90 felvvkv 96 
                          f   v +
  GSBRNA2T00042488001 106 F--DVNI 110
                          9..5544 PP

2B330.56.2e-10197272987
                          HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
                   B3   9 dvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                            + +g +++p+ f +++  ++++ +t+  + + g sWev +    +  + ++++GW++ +++  L+ gD ++++l++ 
  GSBRNA2T00042488001 197 KRSGLGHVTIPNLFKKHIP-NEQTMFTIHSKGSGGGSWEVWC--LVREAQATFSRGWSKLAREYPLEIGDKCTLQLIKP 272
                          555667799**99975554.445678999999999*******..77777789***********************9974 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.104.3E-1613114IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.85E-1714117IPR015300DNA-binding pseudobarrel domain
CDDcd100171.43E-1418111No hitNo description
PROSITE profilePS5086311.61719114IPR003340B3 DNA binding domain
SMARTSM010199.3E-1719114IPR003340B3 DNA binding domain
PfamPF023621.5E-1319109IPR003340B3 DNA binding domain
SuperFamilySSF1019361.49E-11187278IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.8E-10189280IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508639.206189283IPR003340B3 DNA binding domain
CDDcd100173.05E-7190273No hitNo description
SMARTSM010192.4E-5192283IPR003340B3 DNA binding domain
PfamPF023625.2E-8194274IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MDMNNWFDRV KEDRKNLSFS KTFACADLSS ECMRTFPFDL MKSLPKENLA NKMVIIAKWG  60
SSWEVDISKN PRFYYMEKSG WNQFVRDNAL GKNEFVTFTH KGSMCFDVNI YGKDEKEVVR  120
PPTMASSSGI KQEQGASMEG VEFEATEKKA EESKKKIKIK KVVNSVEIGE SSRGVKKVKR  180
GRVRVKNGVP EFEMTIKRSG LGHVTIPNLF KKHIPNEQTM FTIHSKGSGG GSWEVWCLVR  240
EAQATFSRGW SKLAREYPLE IGDKCTLQLI KPNECVLTID SNKAKEEEIT VID*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009141415.10.0PREDICTED: B3 domain-containing protein At3g17010-like
RefseqXP_009141417.10.0PREDICTED: B3 domain-containing protein At3g17010-like
TrEMBLA0A078JGT00.0A0A078JGT0_BRANA; BnaAnng19510D protein
STRINGBra021943.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56521135
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G17010.11e-76B3 family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]