PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00041030001
Common NameGSBRNA2T00041030001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CPP
Protein Properties Length: 265aa    MW: 29976.5 Da    PI: 10.0526
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00041030001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR46.86e-154781135
                  TCR  1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCed 35
                         ++k+gCnCkks+ClkkYCeCf++g+ Cs +C+Ce+
  GSBRNA2T00041030001 47 RHKRGCNCKKSNCLKKYCECFQSGVGCSINCRCEG 81
                         589******************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5163416.143187IPR005172CRC domain
SMARTSM011141.8E-124785IPR033467Tesmin/TSO1-like CXC domain
PfamPF036387.8E-114981IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MKTLSWLLVN RLNPEIPLHL LLKSSESQTP SWTLVQDDAS KTRASARHKR GCNCKKSNCL  60
KKYCECFQSG VGCSINCRCE GSYLHAIMER RLEEDHETYE KRTTKIQENK QVKQNPSSDQ  120
PSTPLPPYRH LVDHQPSLSK NRLPPTQFFL GVGSSSFRKP ESYSTQSRNE TKPLETVTEE  180
KTEIMYEILS NNPITTIKAI SPNSKRVFPP KLGSSESGSI LVKRSNCRKL ILWSIPAFPS  240
LKPKSVKKKP FYQPTVCIFV MGST*
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed at the first stage of pollen development in uninucleate microspores and bicellular pollen but not in tricellular and mature pollen. {ECO:0000269|PubMed:18057042}.
UniprotTISSUE SPECIFICITY: Ubiquitous but expressed mostly in flowers with highest levels in developing ovules and microspores. {ECO:0000269|PubMed:10769244, ECO:0000269|PubMed:10769245, ECO:0000269|PubMed:18057042}.
Functional Description ? help Back to Top
Source Description
UniProtProbable floral-specific cell division component, required for proper organ formation in flowers. Regulates the floral meristem cell division and the inflorescence meristem organization. Plays a role in development of both male and female reproductive tissues. {ECO:0000269|PubMed:10769244, ECO:0000269|PubMed:10769245, ECO:0000269|PubMed:9043081, ECO:0000269|PubMed:9725857}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00041030001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020886693.11e-105CRC domain-containing protein TSO1
SwissprotQ9LUI31e-105TSO1_ARATH; CRC domain-containing protein TSO1
TrEMBLA0A078JFC60.0A0A078JFC6_BRANA; BnaCnng43520D protein
STRINGBo1g104870.11e-164(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.11e-105Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Lu T,Dou Y,Zhang C
    Fuzzy clustering of CPP family in plants with evolution and interaction analyses.
    BMC Bioinformatics, 2013. 14 Suppl 13: p. S10
    [PMID:24268301]
  2. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  3. Xie W, et al.
    Exploring potential new floral organ morphogenesis genes of Arabidopsis thaliana using systems biology approach.
    Front Plant Sci, 2015. 6: p. 829
    [PMID:26528302]
  4. Wang W,Sijacic P,Xu P,Lian H,Liu Z
    Arabidopsis TSO1 and MYB3R1 form a regulatory module to coordinate cell proliferation with differentiation in shoot and root.
    Proc. Natl. Acad. Sci. U.S.A., 2018. 115(13): p. E3045-E3054
    [PMID:29535223]