PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00041026001
Common NameGSBRNA2T00041026001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CPP
Protein Properties Length: 597aa    MW: 65469.4 Da    PI: 7.4883
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00041026001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.73.5e-16317355240
                  TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                          ++k+CnCkkskClk+YCeCfaag++C e C+C dC+Nk 
  GSBRNA2T00041026001 317 SCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCIDCFNKP 355
                          689**********************************96 PP

2TCR52.31.1e-16402440139
                  TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                          ++k+gCnCkks+ClkkYCeC+++g+ Cs +C+Ce+CkN 
  GSBRNA2T00041026001 402 RHKRGCNCKKSNCLKKYCECYQSGVGCSINCRCEGCKNA 440
                          589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.4E-19316357IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.543317442IPR005172CRC domain
PfamPF036385.6E-12319354IPR005172CRC domain
SMARTSM011144.2E-17402443IPR033467Tesmin/TSO1-like CXC domain
PfamPF036385.5E-12404440IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 597 aa     Download sequence    Send to blast
MATRFYLGLF KGFDGSDNSP VFNYINSLSP ITTVKSISNA QTFSSLSFTS PPPVFTTPHV  60
ASHKGSRFRS HSNSSDPSNK VVEEALLEKE PPQILNNECL TTTPRVTNDG ACEYGETDLQ  120
KMCDDNVKRK SDTPDWETLI SDSSDMLIYG SPNDSEAFRC FLQRSSDSKT RLCDGGSKPA  180
LVAPVSQSNE PESSDALSIL HRGVRRRCLD FEMPRNNNQT PRCVVPSIGL HLNAIAMSSK  240
DNNNVSKEYS FTGNVKVGLQ SSTTPVLPSD DIGRDNEIRE AAGVEEAPLS LALVEVNQSS  300
PKKKRQVSEQ AGEGESSCKR CNCKKSKCLK LYCECFAAGV YCIEPCSCID CFNKPIHEDT  360
VLATRKQIES RNPLAFAPKV IRNSDSTIEV GEDASKTPAS ARHKRGCNCK KSNCLKKYCE  420
CYQSGVGCSI NCRCEGCKNA FGRKDGSSFA GMDTEQDQEN ETSGKSGTTI PLPPSTPMPL  480
RQPLAQLPIS SNNMLPSQQS QQHLHGASLY NSQSFRKQDM GLMSHSRIET IAEERAEDIE  540
NFIHSPVTNI NALSPNSKRV SLPHMDSTET THWRRNGGRK LLLSSIPTFP SLTPHH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A3e-1731943912120Protein lin-54 homolog
5fd3_B3e-1731943912120Protein lin-54 homolog
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous but expressed mostly in flowers and at significant levels in leaves. Detected with highest levels in developing ovules and microspores, and in petals. {ECO:0000269|PubMed:10769245, ECO:0000269|PubMed:18057042}.
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00041026001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2051421e-145AF205142.1 Arabidopsis thaliana CXC domain containing TSO1-like protein 1 (SOL1) mRNA, complete cds.
GenBankAY0996531e-145AY099653.1 Arabidopsis thaliana unknown protein (At3g22760) mRNA, complete cds.
GenBankAY1288371e-145AY128837.1 Arabidopsis thaliana unknown protein (At3g22760) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013607445.10.0PREDICTED: protein tesmin/TSO1-like CXC 3 isoform X2
RefseqXP_022559640.10.0protein tesmin/TSO1-like CXC 3 isoform X2
SwissprotQ8L5480.0TCX3_ARATH; Protein tesmin/TSO1-like CXC 3
TrEMBLA0A078JDA30.0A0A078JDA3_BRANA; BnaCnng43510D protein
STRINGBo1g104900.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22760.10.0Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]