PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00038173001
Common NameGSBRNA2T00038173001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB_related
Protein Properties Length: 445aa    MW: 49907.9 Da    PI: 9.7486
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00038173001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.51.8e-09133175346
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                           WT+eE ++l ++++++  + ++ Ia ++++ Rtl+++k+r+++
  GSBRNA2T00038173001 133 VWTKEETDQLFELCERFDLR-FTVIADRFPLSRTLEELKDRYYS 175
                          6*******************.*********************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF162821.7E-29106180IPR032563DAMP1, SANT/Myb-like domain
SMARTSM007172.7E-9130179IPR001005SANT/Myb domain
SuperFamilySSF466898.16E-7131182IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.1E-7134178IPR009057Homeodomain-like
CDDcd116584.81E-18134176No hitNo description
PfamPF054992.5E-7322390IPR008468DNA methyltransferase 1-associated 1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 445 aa     Download sequence    Send to blast
MGGTDAKDIL GLRKTPLSLS HEKKARPQKE SHRKPDGISR EVYALTGGVA PPLMPSIDVT  60
HLKRPPPPHE KVAWQWLPIN SSARKDDLQL YHWVRVVNGV PPTGDYSFAK YNKSVDILKY  120
TDDDYENLLT DPVWTKEETD QLFELCERFD LRFTVIADRF PLSRTLEELK DRYYSVTRAL  180
LRARAQSPAD LANHPLMKEP YDMTRDRERK RALSMVLSQS RHQEKKDAEI LAEAKRITEI  240
RLAARRAADL DVSGNENIGL DKADGGPGCS VSPSSNSQLP ATAVAPSTLT MADYASTLAS  300
LRMLHVYLRT YGLEQMVQAA SSAVGLRTIK RVEQTLQDLG VNLKPKVPTK TVCDEHLELR  360
KEILTLLNLQ KQLQYKESEG SSHREGAYAA MPDTPKDRVF ASEPFSFGAE RPIKKEPKRK  420
GPGRQADTPS PAHKRPRKLK ASDL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3hm5_A4e-18105185488DNA methyltransferase 1-associated protein 1
4iej_A4e-18105185488DNA methyltransferase 1-associated protein 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.215980.0vegetative meristem
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00038173001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3530190.0AK353019.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-19-J15.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013748609.10.0PREDICTED: SWR1-complex protein 4-like isoform X2
SwissprotQ8VZL60.0SWC4_ARATH; SWR1-complex protein 4
TrEMBLA0A078GQQ40.0A0A078GQQ4_BRANA; BnaC04g51430D protein
STRINGscaffold_403698.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM85432435
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47210.10.0MYB_related family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]