PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00037888001
Common NameGSBRNA2T00037888001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRAS
Protein Properties Length: 563aa    MW: 61780.8 Da    PI: 6.2622
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00037888001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS310.15.2e-951985592374
                 GRAS   2 velLlecAeavss.gdlelaqalLarlsel.aspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                          +e+Ll++Ae+++  g+++ aq +Larl+++ +sp g++++R+a+y+ eAL++ l++      ++ + ++ ++++ + +++a+k fse+sP
  GSBRNA2T00037888001 198 TEQLLKVAEVMERgGETSVAQGILARLNQQlSSPVGKAFERAAFYYIEALHNSLLH-----NNKASQTPLNPYSLIFKISAYKSFSEISP 282
                          689********9967899**********998************************9.....6667777888888**************** PP

                 GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLa.sRp..egpp.slRiTgvgspesg.skeeleetgerLakfAeelgv 174
                          +l+f+++t Nqa+le+++g +r+HiiDfdi++G++W++L+q+L   R   + pp sl+iT+++sp+++ ++ el  t+++L++fA+e+++
  GSBRNA2T00037888001 283 VLQFANFTSNQALLESFHGFTRLHIIDFDIGYGGHWASLMQELVlLRVdnHAPPlSLKITVFASPDHHqHQLELAFTQDNLKHFASEINI 372
                          ********************************************65657644556***********998999****************** PP

                 GRAS 175 pfefnvlvakrledleleeL...rvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqe.adhnsesFlerflea 260
                          +++++vl   +l+ l   +L   + +++Ea+aVnl+ + ++          + + +L++vk+lsP ++v++++  +++++ +F +++l++
  GSBRNA2T00037888001 373 SLDIQVL---SLDLL--ASLswpSSDKEEAVAVNLSPASFSNT--------PSSLLLRFVKHLSPSIIVCSDRGgCERTDLPFPQQLLHS 449
                          ******8...55555..3441115566*********9777665........34689*****************97899************ PP

                 GRAS 261 leyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyr 350
                          l+ ++al++sl+a   ++ ++++k+Er+l+++ei+++v  + +     ++ +++W+++++++GF+pv+ s+++++qa++l+++++++g++
  GSBRNA2T00037888001 450 LQSHAALLESLDAV-NANLDAMHKIERFLIQPEIEKLVLDRSRP---IQRPMMTWHAMFMQMGFSPVTHSNFTESQAECLVQRTPVRGFH 535
                          ***********887.5677*********************9998...77788************************************** PP

                 GRAS 351 veeesgslvlgWkdrpLvsvSaWr 374
                          ve++++sl+l+W++ +Lv vSaWr
  GSBRNA2T00037888001 536 VEKKHNSLLLCWQRTELVGVSAWR 559
                          ***********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098538.107172539IPR005202Transcription factor GRAS
PfamPF035141.8E-92198559IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 563 aa     Download sequence    Send to blast
MPLPFAEFQG KVISSYFSSD IEPTSVLSPL TTSSSTVSSS HGVNAAVGGG GISTAISGGD  60
EQCGASDWER VLPASPTHDH DHDNDQSILR LIMMGDSQDP SLELNNILQT SQSPATFHHS  120
DYTSLGSFGV VVDTTTGFGG LDHSVPALFQ SQVPPQHPVL INQSQTHFTQ NPSLLYGHQI  180
PAAKRLNQGG SVGEGMITEQ LLKVAEVMER GGETSVAQGI LARLNQQLSS PVGKAFERAA  240
FYYIEALHNS LLHNNKASQT PLNPYSLIFK ISAYKSFSEI SPVLQFANFT SNQALLESFH  300
GFTRLHIIDF DIGYGGHWAS LMQELVLLRV DNHAPPLSLK ITVFASPDHH QHQLELAFTQ  360
DNLKHFASEI NISLDIQVLS LDLLASLSWP SSDKEEAVAV NLSPASFSNT PSSLLLRFVK  420
HLSPSIIVCS DRGGCERTDL PFPQQLLHSL QSHAALLESL DAVNANLDAM HKIERFLIQP  480
EIEKLVLDRS RPIQRPMMTW HAMFMQMGFS PVTHSNFTES QAECLVQRTP VRGFHVEKKH  540
NSLLLCWQRT ELVGVSAWRC RS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-2422955933375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009111514.10.0PREDICTED: scarecrow-like protein 6
RefseqXP_013697066.10.0PREDICTED: scarecrow-like protein 6
SwissprotO813160.0SCL6_ARATH; Scarecrow-like protein 6
TrEMBLA0A078JEC40.0A0A078JEC4_BRANA; BnaAnng18550D protein
STRINGBra037319.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM85742739
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.10.0GRAS family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]