PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00034486001
Common NameGSBRNA2T00034486001, LOC106345494
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 348aa    MW: 39538.1 Da    PI: 4.8147
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00034486001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260122.62.1e-38381381101
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          aCaaCk++rr+Ca+dC+lapyfpaeqpk f+nvh+lFG++ ++k+l++l+e +r++am+s+++++ +r r+Pv+G++g+ ++lq  +  +
  GSBRNA2T00034486001  38 ACAACKYQRRRCAADCPLAPYFPAEQPKLFQNVHRLFGVRSIVKILENLDEVQRPEAMKSIIFQSYVRDRNPVHGCLGITQQLQYMIWVA 127
                          7***************************************************************************************** PP

               DUF260  91 kaelallkeel 101
                          ++el++++++l
  GSBRNA2T00034486001 128 EEELKAVNSQL 138
                          *****999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.30437138IPR004883Lateral organ boundaries, LOB
PfamPF031956.1E-3538135IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MSQIKTIHNP IGSLERFLDL LLISLIVYMT LKGGTSGACA ACKYQRRRCA ADCPLAPYFP  60
AEQPKLFQNV HRLFGVRSIV KILENLDEVQ RPEAMKSIIF QSYVRDRNPV HGCLGITQQL  120
QYMIWVAEEE LKAVNSQLQL YRSGQNHPNP HNMMIHEIGE KQEDLTSQLD LGMGLPVNNN  180
NQGNNTIPFF SPVSETQQQQ PHMSYCSDQV NNHDYNPIPD SCKEVLNNHN TSLAWGQNQF  240
PYNHHNYGFI NQNEHCSETK NNNSVMAIQS QLVNLQMASN QQEEEVDDQN YDEIHQFLEI  300
IDESQSFTET KEVYASSSGE SLKEPIDEIG EEELRRAATC FSLTSVN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-25341457118LOB family transfactor Ramosa2.1
5ly0_B3e-25341457118LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.282320.0microspore
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00034486001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013640147.10.0LOB domain-containing protein 27
SwissprotQ9STS61e-123LBD27_ARATH; LOB domain-containing protein 27
TrEMBLA0A078J9P20.0A0A078J9P2_BRANA; BnaAnng17790D protein
STRINGBo3g135950.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63032746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.11e-125LOB domain-containing protein 27
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  2. Kim MJ,Kim M,Kim J
    Combinatorial interactions between LBD10 and LBD27 are essential for male gametophyte development in Arabidopsis.
    Plant Signal Behav, 2015. 10(8): p. e1044193
    [PMID:26252070]
  3. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]