PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00034345001
Common NameGSBRNA2T00034345001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family NAC
Protein Properties Length: 520aa    MW: 57964.6 Da    PI: 4.4613
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00034345001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.13e-5291361128
                  NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                          l+pGfrFhPtdeelv +yLk+kv +k++++ ++i+ +d+yk+ePwdLp k k+k+++ ewyfFs  dkky++g+++nrat++gyWk+tgk
  GSBRNA2T00034345001   9 LAPGFRFHPTDEELVRYYLKRKVCNKPFNF-DAISVADVYKSEPWDLPdKsKLKGRDLEWYFFSMLDKKYSNGSKTNRATERGYWKTTGK 97 
                          579**************************9.99**************95346777777******************************** PP

                  NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          d+e+ + ++++vg+kktLv++kgrap+ge+++Wvmheyrl
  GSBRNA2T00034345001  98 DREIRN-GTRAVGMKKTLVYHKGRAPRGERSNWVMHEYRL 136
                          *****9.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.88E-607159IPR003441NAC domain
PROSITE profilePS5100558.0189159IPR003441NAC domain
PfamPF023657.9E-2811136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 520 aa     Download sequence    Send to blast
MGRGSATSLA PGFRFHPTDE ELVRYYLKRK VCNKPFNFDA ISVADVYKSE PWDLPDKSKL  60
KGRDLEWYFF SMLDKKYSNG SKTNRATERG YWKTTGKDRE IRNGTRAVGM KKTLVYHKGR  120
APRGERSNWV MHEYRLTDDE LKIAGAPQDA FVLCRVFQKS GTGDKYGAPC LEEEWEEDTM  180
TFAPEQEALS EVYLECVILH VLKSYISDKP EDLVVYDTIP VQTNYCHGES SNNVESGNYE  240
DCGNSGGYFE QPIEEEEEQK PIIRDGSIQP CSLFPGEQIG CGVEDEKAVN LEASNDNVFV  300
ADTCYSGIPV DDVNYMPEEP FIDHSNNLPL SDGLSGAPLQ DDFNFEDYLN FFDDEDAQNL  360
SLDVSQLLGS EEGLDQKPSP EELEKEKESG EGSSSKQDAD VTDLDSASKY PFLKKASHIF  420
ASSQFQTKDA AIRLHAAQSG SVHVTAGMIR ISNMTTLAAD SSMGWSYDKN GNLNIVLSLG  480
LVQSKTGGIT ATRAMLIFMC FWILVLYVSF KIGTIVSAR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-44816519174NAC domain-containing protein 19
3swm_B2e-44816519174NAC domain-containing protein 19
3swm_C2e-44816519174NAC domain-containing protein 19
3swm_D2e-44816519174NAC domain-containing protein 19
3swp_A2e-44816519174NAC domain-containing protein 19
3swp_B2e-44816519174NAC domain-containing protein 19
3swp_C2e-44816519174NAC domain-containing protein 19
3swp_D2e-44816519174NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.129870.0microspore| microspore-derived embryo| root| seed
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in root meristem (Ref.1). Expressed in roots, rosette leaves, cauline leaves, shoot apex, stems and flowers (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|Ref.1}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (By similarity). Transcripition activator associated with the induction of genes related to flavonoid biosynthesis and required for the accumulation of anthocyanins in response to high light stress (PubMed:19887540). Plays a role in the regulation of 20S and 26S proteasomes in response to high light stress (PubMed:21889048). {ECO:0000250|UniProtKB:Q949N0, ECO:0000269|PubMed:19887540, ECO:0000269|PubMed:21889048}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00034345001
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By exposure to high light (PubMed:19887540). Induced by heat and methyl methanesulfonate (MMS) treatment (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|PubMed:19887540}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013620811.10.0PREDICTED: NAC domain-containing protein 78-like isoform X2
SwissprotQ84K000.0NAC78_ARATH; NAC domain-containing protein 78
TrEMBLA0A078J5Q10.0A0A078J5Q1_BRANA; BnaAnng17650D protein
STRINGBra028790.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31922762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.10.0NAC domain containing protein 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  4. Liang M, et al.
    Subcellular Distribution of NTL Transcription Factors in Arabidopsis thaliana.
    Traffic, 2015. 16(10): p. 1062-74
    [PMID:26201836]
  5. Xiao D, et al.
    SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1275-91
    [PMID:26304848]
  6. Gladman NP,Marshall RS,Lee KH,Vierstra RD
    The Proteasome Stress Regulon Is Controlled by a Pair of NAC Transcription Factors in Arabidopsis.
    Plant Cell, 2016. 28(6): p. 1279-96
    [PMID:27194708]
  7. Tang Y,Zhao CY,Tan ST,Xue HW
    Arabidopsis Type II Phosphatidylinositol 4-Kinase PI4Kγ5 Regulates Auxin Biosynthesis and Leaf Margin Development through Interacting with Membrane-Bound Transcription Factor ANAC078.
    PLoS Genet., 2016. 12(8): p. e1006252
    [PMID:27529511]