PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00033948001
Common NameGSBRNA2T00033948001, LOC106365465
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 206aa    MW: 23275.9 Da    PI: 10.2114
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00033948001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260110.41.3e-3424115192
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          aCa+Ck++r+kC+++C+l+pyfpa+++k+f++vhk+FG+snv+k+++++++e+r+++ +sl++eA +r++dPv G++g +++++++l+  
  GSBRNA2T00033948001  24 ACASCKHQRKKCNNECILSPYFPARKTKEFQAVHKVFGVSNVQKMVRTVRDEDRTKLSESLTWEALWRQKDPVLGSYGEYRRISEELKLY 113
                          7************************************************************************************99987 PP

               DUF260  91 ka 92 
                          k+
  GSBRNA2T00033948001 114 KS 115
                          75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.84823123IPR004883Lateral organ boundaries, LOB
PfamPF031953.2E-3224115IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MMQRNSTNNT NNNSISNNPS SHQACASCKH QRKKCNNECI LSPYFPARKT KEFQAVHKVF  60
GVSNVQKMVR TVRDEDRTKL SESLTWEALW RQKDPVLGSY GEYRRISEEL KLYKSLVHNQ  120
PVIGWDNNHQ RLINNNNKNG LVVNSSGSGG FSVNNNGVGG NRDVINGGFI SRNLQGGYEN  180
LRQDQRQQCY AVINGFKQHH LPLSN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A9e-1914101188LOB family transfactor Ramosa2.1
5ly0_B9e-1914101188LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.111030.0flower
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00128DAPTransfer from AT1G06280Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00033948001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013603628.11e-151PREDICTED: LOB domain-containing protein 2-like
RefseqXP_013660343.11e-151LOB domain-containing protein 2
SwissprotQ9LNB91e-112LBD2_ARATH; LOB domain-containing protein 2
TrEMBLA0A078K3Y51e-150A0A078K3Y5_BRANA; BnaCnng78580D protein
TrEMBLA0A0D3DJ501e-150A0A0D3DJ50_BRAOL; Uncharacterized protein
STRINGBo8g006050.11e-151(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM105392635
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.12e-91LOB domain-containing protein 2
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]