PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00031984001
Common NameGSBRNA2T00031984001, LOC106402000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 394aa    MW: 43217.7 Da    PI: 6.1908
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00031984001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.71.6e-10189247563
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                          kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L  +l  l+     l  e+
  GSBRNA2T00031984001 189 KRAKRIWANRQSAARSKERKMRYIAELERKVQTLQTEATTLSAQLTLLQRDTNGLSVEN 247
                          9********************************************99998877776665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.1E-15185249IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.657187250IPR004827Basic-leucine zipper domain
PfamPF001704.8E-9189241IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.74E-11189240No hitNo description
Gene3DG3DSA:1.20.5.1709.7E-11189243No hitNo description
CDDcd147036.18E-25190239No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 394 aa     Download sequence    Send to blast
MDKEKSPAPP PSGGLPPPSG RYSAFPPLTP PPSGSSDANR FSHDISRMPD NPPKNLGHRR  60
AHSEILTLPD DLSFDSDLGV VGGAPDGPSF SDDADEDLMS MYLDMDKFNS SASSSCEPAE  120
LVWRNELAST TTPGGVGSSE RPRIRHQHSQ SMDGSTSLMS GSEDVSGGVD SKKAISAAKL  180
SELALIDPKR AKRIWANRQS AARSKERKMR YIAELERKVQ TLQTEATTLS AQLTLLQRDT  240
NGLSVENHEL KLRVQTVEQQ VHLQDALNDA LKEEVQHLKV LTGQGVSNGG ASSVMNYGSF  300
GSSNQQFYTN NQSMHTMQAT QQFQQLQIHS QKQQQQFQFQ QQQQLYQLQL QQQRIQQQEQ  360
QSGVAEPRRP MSSSGQKESV TSSPDLESPS TKD*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.128690.0microspore
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed constitutively at a low level in young seedlings and in roots, stems and leaves of mature plants.
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor with an activatory role.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00031984001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013698086.10.0probable transcription factor PosF21
SwissprotQ040881e-168POF21_ARATH; Probable transcription factor PosF21
TrEMBLA0A078F6R30.0A0A078F6R3_BRANA; BnaC05g04130D protein
TrEMBLA0A3P6FBT40.0A0A3P6FBT4_BRAOL; Uncharacterized protein
STRINGBo5g007170.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24452772
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.11e-154bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  3. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]