PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00030498001
Common NameGSBRNA2T00030498001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRAS
Protein Properties Length: 540aa    MW: 59990.9 Da    PI: 4.8439
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00030498001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS429.13.6e-1311695393374
                 GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                          + L++cA a+s+g+ e+a +lL++l++++s +gdp qR+aay++e+Laar+a s++ ly+al+++e +   s+e+laa+++++ev+P++k
  GSBRNA2T00030498001 169 QMLISCALALSEGKSEEALSLLNELRQIVSIQGDPSQRIAAYMVEGLAARMAASGKFLYRALRCKEPP---SDERLAAMQVLFEVCPCFK 255
                          79*****************************************************************9...9****************** PP

                 GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnv 180
                          f++l+aN aI+e++  e++vHiiDfd++qG Q+++L++++a+ p++ p +R+Tgv++pes+  s   l+ +g rL+++A+  gv+f+f++
  GSBRNA2T00030498001 256 FGYLAANGAIVESIRDEKEVHIIDFDVNQGNQYMTLIKTIAELPGKGPLMRLTGVDDPESVqrSVGGLRIIGLRLEQLAKDHGVSFKFRA 345
                          ***********************************************************9989999************************ PP

                 GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfds 270
                          +++k+   +++++L +kpgEal+Vn+++qlh+++desv++ ++rd +L++vk+l+Pk+v+vveq++++n+++F+ rf+ea eyysa+fds
  GSBRNA2T00030498001 346 VASKTSLIVSPSALGCKPGEALIVNFAFQLHHMPDESVTVVNQRDVLLHMVKGLNPKLVTVVEQDVNTNTSPFFPRFVEAYEYYSAVFDS 435
                          988899999********************************************************************************* PP

                 GRAS 271 leaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvl 360
                          l+++lpres+er++vEr++l+r+ivnvvaceg+er+er e ++kWr+r+++aGF++ p+++++a ++++l+++ +   y+v+ee g+l++
  GSBRNA2T00030498001 436 LDVTLPRESQERMNVERQCLARDIVNVVACEGEERIERYEVAGKWRARMMMAGFSSRPMGSRVARSMQSLIKEEYCSKYKVKEEMGELLF 525
                          ***************************************************************************666************ PP

                 GRAS 361 gWkdrpLvsvSaWr 374
                          +W+d++L+++SaWr
  GSBRNA2T00030498001 526 YWEDKSLIVASAWR 539
                          *************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.555141519IPR005202Transcription factor GRAS
PfamPF035141.2E-128169539IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 540 aa     Download sequence    Send to blast
MVEQTARVMS LVSSAEPSAA AYKNPKLYSL NENGYNSDGG ASVEIFDPDR SKNTSYFLDS  60
PTEQHPVASG AASVSSFGSL DSFPYQSRPV LGSSMEFDDE QMRSKIQELE RALLSDEDDN  120
IMEGLDHLME IDNEWSYQNH SNKDSSSADS NSHSSSSKEV VSQATTPKQM LISCALALSE  180
GKSEEALSLL NELRQIVSIQ GDPSQRIAAY MVEGLAARMA ASGKFLYRAL RCKEPPSDER  240
LAAMQVLFEV CPCFKFGYLA ANGAIVESIR DEKEVHIIDF DVNQGNQYMT LIKTIAELPG  300
KGPLMRLTGV DDPESVQRSV GGLRIIGLRL EQLAKDHGVS FKFRAVASKT SLIVSPSALG  360
CKPGEALIVN FAFQLHHMPD ESVTVVNQRD VLLHMVKGLN PKLVTVVEQD VNTNTSPFFP  420
RFVEAYEYYS AVFDSLDVTL PRESQERMNV ERQCLARDIV NVVACEGEER IERYEVAGKW  480
RARMMMAGFS SRPMGSRVAR SMQSLIKEEY CSKYKVKEEM GELLFYWEDK SLIVASAWR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-531695396375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.180740.0leaf| seed
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009103294.10.0PREDICTED: scarecrow-like protein 1
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLA0A078JAR60.0A0A078JAR6_BRANA; BnaA07g37270D protein
STRINGBra012280.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM69532744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]