PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00030430001
Common NameGSBRNA2T00030430001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 139aa    MW: 15462.9 Da    PI: 7.4676
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00030430001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260141.42.9e-4481071100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +Ca+Ck+lrr+Cak+C++apyfp ++p+kfa+vhk+FGasnv+k+l++lp ++r da++slv+eA+ar+rdPvyG+vg i+ lq+q+ ql
  GSBRNA2T00030430001   8 PCASCKLLRRRCAKECIFAPYFPPDDPHKFAIVHKVFGASNVSKMLQELPVHQRADAVNSLVFEANARVRDPVYGCVGAISYLQNQVTQL 97 
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          + +la++++e
  GSBRNA2T00030430001  98 QMQLAVAQTE 107
                          *****99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.6817108IPR004883Lateral organ boundaries, LOB
PfamPF031959.9E-448105IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 139 aa     Download sequence    Send to blast
MGGPGSSPCA SCKLLRRRCA KECIFAPYFP PDDPHKFAIV HKVFGASNVS KMLQELPVHQ  60
RADAVNSLVF EANARVRDPV YGCVGAISYL QNQVTQLQMQ LAVAQTEILC IQMQHEPTLQ  120
SHHEMQMQDP LKQESLWT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-4941186124LOB family transfactor Ramosa2.1
5ly0_B3e-4941186124LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed predominantly in roots, and at low levels in shoots, floral stems and open flowers. {ECO:0000269|PubMed:12068116}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00030430001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1643061e-129AB164306.1 Arabidopsis thaliana ASL5 mRNA for ASYMMETRIC LEAVES2-like gene 5 protein, partial cds.
GenBankAB4738381e-129AB473838.1 Arabidopsis thaliana ASL5 mRNA for ASYMMETRIC LEAVES2-like 5 protein, complete cds.
GenBankAY0869601e-129AY086960.1 Arabidopsis thaliana clone 29970 mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009132714.12e-91PREDICTED: LOB domain-containing protein 12-like
RefseqXP_013642854.12e-91LOB domain-containing protein 12-like
RefseqXP_013733963.12e-91LOB domain-containing protein 12-like
RefseqXP_022571595.12e-91LOB domain-containing protein 12-like
SwissprotQ8LBW32e-86LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A078K4532e-99A0A078K453_BRANA; BnaA03g56340D protein
STRINGBra022780.1-P2e-91(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.16e-89LBD family protein
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]
  2. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]