PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00029882001
Common NameGSBRNA2T00029882001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 189aa    MW: 21168.6 Da    PI: 6.7278
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00029882001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_129.31.9e-0957102550
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                           + rr   NReA r++R++Kka+++ Le++v+ L++ N+ L  +l+
  GSBRNA2T00029882001  57 SNKRRSCGNREAVRKYREKKKARTAYLEDEVQRLQSMNEFLLRKLQ 102
                          67899999*******************************9988876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.9E-752120IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1708.5E-1253120No hitNo description
PfamPF077161.4E-1553102IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.08255121IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.0E-756103No hitNo description
CDDcd146864.25E-1065103No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042538Biological Processhyperosmotic salinity response
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MDGEEVEAWA RASGGCSHTH SCNPPGPEDA SHSHTCFHTH THLIIPDSQE NGHSDSSNKR  60
RSCGNREAVR KYREKKKART AYLEDEVQRL QSMNEFLLRK LQSQAIVEAE IVRLRTLLVE  120
MQGTMNDELG GFSFQKQCNG SGFVFKEDGC NVATRNMICE VARVECEEGK TLHEPVHSFV  180
PHSPPFSR*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young leaves and cauline leaves. {ECO:0000269|PubMed:19248824}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in the regulation of salt stress response. Functions as a negative transcriptional regulator of salt stress acclimation response by regulating cation homeostasis (PubMed:18703123, PubMed:19248824). Regulates negatively the expression of genes contributing to ion and osmotic homeostasis during salt stress, such as the Na(+) transporter HKT1, the Na(+)/H(+) antiporter SOS1, the aquaporin PIP2-1 and the glutamine synthetase GLN1-3. In addition, targets genes with functions in plant growth and development, such as argonaute 4 (AGO4) and cyclophilin 19 (CYP19) (PubMed:19248824). {ECO:0000269|PubMed:18703123, ECO:0000269|PubMed:19248824}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00029882001
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salt stress (PubMed:18703123, PubMed:19248824). Induced by osmotic stress (PubMed:19248824). {ECO:0000269|PubMed:18703123, ECO:0000269|PubMed:19248824}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1176291e-159AK117629.1 Arabidopsis thaliana At3g51960 mRNA for putative bZip transcription factor Atbzip24, complete cds, clone: RAFL17-28-M01.
GenBankBT0054221e-159BT005422.1 Arabidopsis thaliana clone U50385 putative bZIP family transcription factor (At3g51960) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013631502.11e-141PREDICTED: uncharacterized protein LOC106337035
SwissprotQ8GTS11e-107BZP24_ARATH; Basic leucine zipper 24
TrEMBLA0A078J7J51e-139A0A078J7J5_BRANA; BnaCnng36700D protein
TrEMBLA0A3P6C8D11e-139A0A3P6C8D1_BRAOL; Uncharacterized protein
STRINGBra033464.1-P1e-129(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM151721518
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51960.12e-97basic leucine zipper 24
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]