PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00029566001
Common NameGSBRNA2T00029566001, LOC106364105, LOC106379571
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family M-type_MADS
Protein Properties Length: 305aa    MW: 34482 Da    PI: 8.4786
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00029566001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF52.56.5e-171051243
                         ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
               SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                         +i n+s r+ tf kR++g++KK +ELS+LC+++++ ii+s+ 
  GSBRNA2T00029566001 10 FIANDSSRKATFKKRKKGLIKKVNELSTLCGINACAIIYSPY 51
                         899*************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006617.058149IPR002100Transcription factor, MADS-box
SMARTSM004321.9E-24160IPR002100Transcription factor, MADS-box
CDDcd002664.63E-24285No hitNo description
SuperFamilySSF554554.45E-25295IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-8323IPR002100Transcription factor, MADS-box
PfamPF003191.2E-171051IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-82338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MTRKKVKLAF IANDSSRKAT FKKRKKGLIK KVNELSTLCG INACAIIYSP YDTNPEVWPS  60
NSGVQRIISD FRKLPEMDQN KKMVDQEAFL RQRIAKASEN LKKQRKDNRE MEMTEVMFQC  120
LVGNMGMFNL NIMDLNDLGY MIDQYLKDVN RRIEILGSSG GGMELGETSN DAAAAPSEAA  180
GTLAIVPTTT DTIQPYHHQQ QHQMFRHHAA PHVGPYEQPL NLNLSHSQNQ QQGFTEMMMN  240
RPEQMSYAAE QMGFPFMNDN HHHHHYHHHQ QVPGESSTTP ATNVSASSAN PVTSSNPTNH  300
IWFR*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKVKLAFIANDSSRKATFKKRK
22125KKRKK
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the central cell of the female gametophyte and in early endosperm. Also detected in ovaries, young siliques, roots, leaves, stems, young flowers and anthers. {ECO:0000269|PubMed:16798889}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. Controls central cell differentiation during female gametophyte development. Required for the expression of DEMETER and DD46, but not for the expression of FIS2 (PubMed:16798889). Probable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction (Probable). {ECO:0000269|PubMed:16798889, ECO:0000305|PubMed:26462908}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00029566001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009114607.10.0PREDICTED: agamous-like MADS-box protein AGL80
RefseqXP_013610078.10.0PREDICTED: agamous-like MADS-box protein AGL80
RefseqXP_013659196.10.0agamous-like MADS-box protein AGL80
RefseqXP_013674953.10.0agamous-like MADS-box protein AGL80
SwissprotQ9FJK31e-110AGL80_ARATH; Agamous-like MADS-box protein AGL80
TrEMBLA0A078J7380.0A0A078J738_BRANA; BnaAnng16690D protein
TrEMBLA0A0D3E8D30.0A0A0D3E8D3_BRAOL; Uncharacterized protein
TrEMBLA0A397XW250.0A0A397XW25_BRACM; Uncharacterized protein
TrEMBLA0A3P6E9T60.0A0A3P6E9T6_BRAOL; Uncharacterized protein
TrEMBLM4EL020.0M4EL02_BRARP; Uncharacterized protein
STRINGBra029469.1-P0.0(Brassica rapa)
STRINGBo9g078450.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.11e-100AGAMOUS-like 80
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  2. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]