PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00024664001
Common NameGSBRNA2T00024664001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family SBP
Protein Properties Length: 162aa    MW: 18479.8 Da    PI: 9.5248
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00024664001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP135.22e-4260135277
                          -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                  SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                          Cqv++C+adl+eak+yhrrhkvCevh+ka++v+++g++qrfCqqCsrfhel efDe+krsCr+rLa+hnerrrk++
  GSBRNA2T00024664001  60 CQVDRCTADLKEAKQYHRRHKVCEVHAKASSVYLTGVKQRFCQQCSRFHELLEFDEAKRSCRKRLAGHNERRRKSS 135
                          **************************************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0375753.7E-571146IPR017238Squamosa promoter-binding protein
Gene3DG3DSA:4.10.1100.103.2E-3354121IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.96657134IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.1E-3859138IPR004333Transcription factor, SBP-box
PfamPF031102.2E-3260133IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009908Biological Processflower development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046872Molecular Functionmetal ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 162 aa     Download sequence    Send to blast
MDGKKTQGQG YLKKKASVSY LVEEELENDT DGEEEEKRKC VTDRFKGSSG SNDRGSSRLC  60
QVDRCTADLK EAKQYHRRHK VCEVHAKASS VYLTGVKQRF CQQCSRFHEL LEFDEAKRSC  120
RKRLAGHNER RRKSSGESII GEGVEMTLPM SNTSFKRPQI R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-4547133184squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00024664001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013646324.11e-111PREDICTED: squamosa promoter-binding-like protein 4 isoform X2
RefseqXP_013646323.11e-111PREDICTED: squamosa promoter-binding-like protein 4 isoform X2
RefseqXP_013752442.11e-111PREDICTED: squamosa promoter-binding-like protein 4 isoform X2
RefseqXP_013752441.11e-111PREDICTED: squamosa promoter-binding-like protein 4 isoform X2
SwissprotQ9S7A94e-72SPL4_ARATH; Squamosa promoter-binding-like protein 4
TrEMBLA0A078GHL41e-116A0A078GHL4_BRANA; Squamosa promoter-binding-like protein
STRINGBra039656.1-P1e-101(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G53160.25e-66squamosa promoter binding protein-like 4
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]