PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00024327001
Common NameGSBRNA2T00024327001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 356aa    MW: 39585.4 Da    PI: 6.0158
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00024327001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.91.5e-10138195562
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                          kr++r + NR +A rs +RK  +i eLe+kv++L++e ++L  +l+  +     l se
  GSBRNA2T00024327001 138 KRAKRIIANRQSAARSKERKARYIMELERKVQTLQTEATTLSAQLSLFQRDTTGLSSE 195
                          9*****************************************9999887776666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.6E-17134198IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.68136199IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.06E-10138189No hitNo description
PfamPF001701.8E-9138196IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.3E-11138192No hitNo description
CDDcd147032.87E-23139188No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MDDSSNAKSN QCPPPLSNPT PTPFRGPYHR RAHSEVQFRL PEDLDLSEPF GGFDDLGSED  60
DIFCTYMDVE KLGSGSDSAG PRSDNPLFSG EEGGSSSSRP RHRHSLSVDG GSSSLESIEA  120
KKAMAPDKLA ELWVVDPKRA KRIIANRQSA ARSKERKARY IMELERKVQT LQTEATTLSA  180
QLSLFQRDTT GLSSENTELK LRLQVMEQQA KLRDALNEQL KEEVERLKFA TGEVSHADAY  240
DLGMAHMQYS QQQQQPPQQQ SFFQHHHHQQ QQTDAQNLQQ MTHQFHLFQP NNNNNNQNPN  300
IMHQATSNAS GQSHSFAEAM SEDPPGRLQG LDISSCGRGS NFGRSDTVSE SSSTM*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. Strongly expressed in mature pollen. {ECO:0000269|PubMed:27896439}.
Functional Description ? help Back to Top
Source Description
UniProtTranscrition factor that may participate with bZIP34 in the gametophytic control of pollen development. {ECO:0000269|PubMed:27896439}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00024327001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0742690.0AY074269.1 Arabidopsis thaliana putative bZIP transcription factor (At2g40620) mRNA, complete cds.
GenBankAY0967460.0AY096746.1 Arabidopsis thaliana putative bZIP transcription factor (At2g40620) mRNA, complete cds.
GenBankZ860930.0Z86093.1 A.thaliana mRNA for b-Zip DNA binding protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013692052.10.0transcription factor RF2b-like
SwissprotO228730.0BZP18_ARATH; bZIP transcription factor 18
TrEMBLA0A078GEY10.0A0A078GEY1_BRANA; BnaC04g01480D protein
TrEMBLA0A3P6C3K90.0A0A3P6C3K9_BRAOL; Uncharacterized protein
STRINGBo4g012700.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40422757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.11e-168bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  3. Pawar V, et al.
    A novel family of plant nuclear envelope-associated proteins.
    J. Exp. Bot., 2016. 67(19): p. 5699-5710
    [PMID:27630107]
  4. Gibalová A, et al.
    Characterization of pollen-expressed bZIP protein interactions and the role of ATbZIP18 in the male gametophyte.
    Plant Reprod, 2017. 30(1): p. 1-17
    [PMID:27896439]
  5. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  6. Babiychuk E,Fuangthong M,Van Montagu M,Inzé D,Kushnir S
    Efficient gene tagging in Arabidopsis thaliana using a gene trap approach.
    Proc. Natl. Acad. Sci. U.S.A., 1997. 94(23): p. 12722-7
    [PMID:9356517]