PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00024209001
Common NameGSBRNA2T00024209001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 337aa    MW: 37701.8 Da    PI: 9.8662
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00024209001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_124.27.4e-082052421754
                          HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1  17 ArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                          A+rsR RK+++i eLe+ v++L+ae ++   el+ l++
  GSBRNA2T00024209001 205 AQRSRVRKLQYISELERNVQTLQAEGSKVSAELDFLNQ 242
                          89*************************99999998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003380.0073194253IPR004827Basic-leucine zipper domain
CDDcd147037.62E-15197244No hitNo description
SuperFamilySSF579597.74E-6205247No hitNo description
Gene3DG3DSA:1.20.5.1701.0E-7205246No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MAGTKGSESV RSLMNPGKNA LLPPKIPFPS GLMGSRHGHK VSVEKAHHHQ RTSSESHLVE  60
EELPFWLDDL LNEPESPSRK SGHRRSASDS YAYLDVANAA TTISDFSYRN PVASIQRGIQ  120
ELDPSQDASF YADGSFLKQR NRPSGARPSW TRESVGGGKH MGASSYISQD ATAETKRLSS  180
EENNSNPQPG AYEADNTKRA KQQFAQRSRV RKLQYISELE RNVQTLQAEG SKVSAELDFL  240
NQRNLILSLE NKALKHRLES IAQEKLIKQL EQEVLEREIG RLRALYQQQQ HTRQQSASHK  300
RASSKDLDSQ FSTLSLNAKD SNCRRDSLSV MGQFHF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00024209001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3529291e-149AK352929.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-09-A16.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013655769.10.0uncharacterized protein At4g06598
SwissprotQ8W3M74e-45Y4598_ARATH; Uncharacterized protein At4g06598
TrEMBLA0A078GFA60.0A0A078GFA6_BRANA; BnaA01g21580D protein
STRINGBo1g087780.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33602444
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58110.21e-175bZIP family protein
Publications ? help Back to Top
  1. Kumekawa N,Hosouchi T,Tsuruoka H,Kotani H
    The size and sequence organization of the centromeric region of Arabidopsis thaliana chromosome 4.
    DNA Res., 2001. 8(6): p. 285-90
    [PMID:11853315]
  2. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]