PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00023319001
Common NameABF4-2.1, GSBRNA2T00023319001, LOC106363379
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 392aa    MW: 42655.7 Da    PI: 9.9115
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00023319001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.33.4e-13315368558
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                          +r+rr++kNRe+A rsR+RK+a++ eLe ++++L++ N++L+k+  e+ ++ ++
  GSBRNA2T00023319001 315 RRQRRMIKNRESAARSRARKQAYTLELEAEIEKLKKVNQELQKKQAEMMEMQKN 368
                          69****************************************998888887665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.6E-10311369IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.553313364IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.88E-10315364No hitNo description
Gene3DG3DSA:1.20.5.1703.7E-13315364No hitNo description
CDDcd147074.56E-24315367No hitNo description
PfamPF001706.9E-11315367IPR004827Basic-leucine zipper domain
PROSITE patternPS000360318333IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MGTHINFNNL GGEGMKPTDN AYPLARQSSL YSLTFDELQS TLLGGPGKDL GSMNMDELLK  60
SIWTAEEAQA MTMNPSSAAT AVAQPGGGIP LQRQGSLTLP RTISQKTVDE VWKCLFTKDG  120
NMVGSSGGGG CGESNAPLRQ QTLGEITVEE FLLRAGVVRE DNSNNGFYSN NGAPGGLGFG  180
FCQPNQNNIS FNGTNDSMIL KQPPHQQFQQ QPSQPQLQPR QQLNQPPHPP QQQHPHQRLP  240
QTIFPKQANV AFAGAGNNAS NNNNNGLGNF GGGGVTVAAT SPGTSSAENN SLSPVPYVLN  300
RGRRSNTGLE KVIERRQRRM IKNRESAARS RARKQAYTLE LEAEIEKLKK VNQELQKKQA  360
EMMEMQKNEE SSKQPWGSKR QCLRRTLTGP W*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.98530.0flower| leaf| root| seed
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, leaves, flowers and immatures siliques. {ECO:0000269|PubMed:11005831, ECO:0000269|PubMed:11884679}.
Functional Description ? help Back to Top
Source Description
UniProtFunctions as transcriptional activator in the ABA-inducible expression of rd29B. Binds specifically to the ABA-responsive element (ABRE) of the rd29B gene promoter. {ECO:0000269|PubMed:11005831, ECO:0000269|PubMed:11884679, ECO:0000269|PubMed:15361142, ECO:0000269|PubMed:16463099}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00023319001
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by drought, salt, abscisic acid (ABA) and cold. {ECO:0000269|PubMed:10636868, ECO:0000269|PubMed:11005831, ECO:0000269|PubMed:16284313, ECO:0000269|PubMed:16463099}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF9747490.0KF974749.1 Brassica napus ABF4-2.1 (ABF4-2.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001303205.10.0ABSCISIC ACID-INSENSITIVE 5-like protein 7
RefseqXP_013658648.10.0ABSCISIC ACID-INSENSITIVE 5-like protein 7 isoform X2
SwissprotQ9M7Q21e-171AI5L7_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 7
TrEMBLX2GFZ70.0X2GFZ7_BRANA; ABF4-2.1
STRINGBo1g114840.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM73427129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19290.33e-74ABRE binding factor 4
Publications ? help Back to Top
  1. Zhang H, et al.
    Identification, expression and interaction analyses of calcium-dependent protein kinase (CPK) genes in canola (Brassica napus L.).
    BMC Genomics, 2014. 15: p. 211
    [PMID:24646378]
  2. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  3. Gao S, et al.
    ABF2, ABF3, and ABF4 Promote ABA-Mediated Chlorophyll Degradation and Leaf Senescence by Transcriptional Activation of Chlorophyll Catabolic Genes and Senescence-Associated Genes in Arabidopsis.
    Mol Plant, 2016. 9(9): p. 1272-1285
    [PMID:27373216]
  4. Fernando VCD,Al Khateeb W,Belmonte MF,Schroeder DF
    Role of Arabidopsis ABF1/3/4 during det1 germination in salt and osmotic stress conditions.
    Plant Mol. Biol., 2018. 97(1-2): p. 149-163
    [PMID:29680877]
  5. Muñiz García MN,Cortelezzi JI,Fumagalli M,Capiati DA
    Expression of the Arabidopsis ABF4 gene in potato increases tuber yield, improves tuber quality and enhances salt and drought tolerance.
    Plant Mol. Biol., 2018. 98(1-2): p. 137-152
    [PMID:30143991]